KEGG   Desulfovibrio magneticus: DMR_02380Help
Entry
DMR_02380         CDS       T00917                                 

Definition
(GenBank) dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00010  Glycolysis / Gluconeogenesis
dma00071  Fatty acid degradation
dma00350  Tyrosine metabolism
dma00625  Chloroalkane and chloroalkene degradation
dma00626  Naphthalene degradation
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01120  Microbial metabolism in diverse environments
dma01130  Biosynthesis of antibiotics
dma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMR_02380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DMR_02380
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DMR_02380
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DMR_02380
   00626 Naphthalene degradation
    DMR_02380
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DMR_02380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: BAH73729
NITE: DMR_02380
UniProt: C4XGE9
Position
250933..252321
Genome map
AA seq 462 aa AA seqDB search
MSHLGQNAPSSKARDKIRPQCRSFPLGLTFCRAAGYFRKRYPESARASPGAAGRHAARGR
AADRRFRPASRAAAPGRAPRSLMRISKFAIPEIIFGRGSIVHLASCAKRVGARRVLFVSD
SGLAKAGWVDRIQEILRDNGLEWVYFDAVNSNPRDHQIHEGADIYVRERADVIIAVGGGS
PMDAAKGIGTIVGNGGSISDYEGANRIMRPLPPMIFLPTTAGSSSDISQFCIITDVARQV
KMSIISRSLVPNVSIIDPLVLLTKSEELIISSAVDAFAHAVESYLSLLSSPFTEHQALKA
IRLIAHNIRPALENRSIEALENLSIASTCAGMSFSNAGLGIGHSLAHSLGGMFDVLHGLV
HPILLPPVMRFNLAVSVDKLANIGRILCGPRMCSNEYLAQAGIAWLEHFFADLRVPVRLR
DILPDSSCLETIAKAAVNDACTLTNPRPASWESLLGVCQEAW
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgagccacttgggtcaaaatgctccatcgtccaaggcgcgagacaaaattcgcccgcaa
tgccgtagcttccccctcggcttgaccttttgccgggcggcgggctactttcgaaaacga
tatcctgaaagcgccagggcttccccaggcgcggccggccggcatgcggcccggggccgc
gcggcggaccggcggtttcggcccgcgtcgcgcgcggccgcccccgggcgcgcgccaagg
agcctcatgcggatcagcaagttcgccattcccgaaatcatcttcggccggggcagcatc
gtccatctggcttcctgcgccaaacgcgtgggcgcgcgccgcgtgctcttcgtcagcgac
agcggcctggccaaggccggctgggttgaccgcatccaggaaatcctgcgcgacaacggc
ctggagtgggtctacttcgacgccgtcaactccaacccccgcgaccaccagattcacgaa
ggggccgacatctacgtgcgcgagcgggccgacgtcatcatcgccgtgggcggcggcagc
cccatggacgcggccaagggcattggcaccatcgtcggtaacggcggcagcatcagcgac
tacgaaggggccaaccgcatcatgcggcccctgccgcccatgatcttcctgcccaccacc
gccggctcaagctcggacatctcccagttttgcatcatcaccgacgtggcccgacaggtg
aagatgtccatcatcagccggtcgctggtgcctaacgtctccatcatcgatccgctggtc
ctcttgaccaagagcgaggaactcatcatttcctcggccgtggacgcctttgcccatgcc
gtggaatcctatctgtcgctgttgtcctcgcctttcaccgagcaccaggccttaaaagcc
atccggctcatcgcccacaacatccgcccggctctggagaaccgctccatcgaggccctg
gaaaacttgagcatcgcctccacctgcgccggcatgtccttttccaacgccggcctgggc
atcggccactccctagcccacagcctgggcggcatgttcgacgtgctccacggcctggtc
catccgatcctgttgccgccggtcatgcgattcaatctggccgtgagcgtggacaagctc
gccaacatcggccgcatcctgtgcgggccccgcatgtgttccaacgagtatctggcccag
gccggcatcgcctggctggaacactttttcgccgatctgcgcgtgcccgtgcggctgcgc
gacatcctgcccgacagcagctgcctggaaaccatcgccaaagccgcggtcaacgacgcc
tgcaccctgaccaacccccggccggctagctgggaatcgctgcttggcgtgtgtcaggag
gcctggtga

DBGET integrated database retrieval system