KEGG   Desulfovibrio magneticus: DMR_11000Help
Entry
DMR_11000         CDS       T00917                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00010  Glycolysis / Gluconeogenesis
dma00052  Galactose metabolism
dma00500  Starch and sucrose metabolism
dma00520  Amino sugar and nucleotide sugar metabolism
dma00521  Streptomycin biosynthesis
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01120  Microbial metabolism in diverse environments
dma01130  Biosynthesis of antibiotics
dma01200  Carbon metabolism
Module
dma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMR_11000
   00052 Galactose metabolism
    DMR_11000
   00500 Starch and sucrose metabolism
    DMR_11000
   00520 Amino sugar and nucleotide sugar metabolism
    DMR_11000
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DMR_11000
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DMR_11000
Enzymes [BR:dma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DMR_11000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAH74591
NITE: DMR_11000
UniProt: C4XLJ7
Position
1216807..1217781
Genome map
AA seq 324 aa AA seqDB search
MADAAVPAVRHLLAADIGGTSSRFGHFELASDGGLTLVSQARLSTQAAASFDDLLAALPA
AGFDLAPAQAAAAVFAVPGAVVGRRVRFANIAWELDLDALEAGHGLKKSACVNDFLAQAH
GCRLLGDTAEVVLPGDMNPGKVQAVIGAGTGLGHACLAPLPGGGVLALASEAGQTAMPFV
CPEETAFAAYLFEATGEGYVRRDTVVTGSGLAHLHRFLTGDDLSPGEVGRLLTPDSPTTA
WFARFYGRAVRDYALTVVAAGGVYLSGGVAAKNPLLVRHPEFAREFYASPTYGDFLRTVA
VRLVRDEDVGLYGAAAMARDLLQA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgccgccgtccccgccgtccggcatctgctggccgccgacatcggcggcacc
tccagccgtttcggccattttgagctggcttcggacggcggattgacccttgtttcccag
gctcgcctgtccacccaggcggcggcgtcctttgacgaccttctggccgccttgccggcg
gccggctttgatctcgccccggcccaggcggcggcggccgttttcgccgtgcccggggcg
gtggtgggacgccgggtgcggttcgccaacatcgcctgggagctggacctcgacgccctt
gaagccgggcatggcctgaaaaaaagcgcctgcgtcaacgatttcctggcccaggcccac
ggctgccggctgcttggcgacacggccgaagtggtgctgcccggcgacatgaacccgggg
aaggtccaggccgtaatcggggccggcaccggccttggtcatgcctgtctggccccgctg
cccggcggcggcgtgctggccctggcttccgaggccggccagacggccatgccctttgtc
tgccccgaggaaaccgcctttgccgcctatcttttcgaggccaccggagagggctacgtc
cgccgcgacaccgtggtgacgggctcggggctggcccatctgcaccgcttcctgaccggc
gacgacctttccccgggcgaggtcgggcggcttctcaccccggacagcccgacgacggcc
tggttcgcccgtttctacggccgggccgtgcgcgactacgccctgaccgtggtggctgcc
ggcggcgtctacttaagtggcggcgtggccgccaaaaatcccctgctggtgcggcatccc
gaattcgcccgggagttttacgcctcccccacgtacggcgattttttgcgcaccgtggcc
gtgcggctggtgcgcgacgaggacgtgggcctttacggggccgccgccatggcgcgtgat
ctgctccaagcctga

DBGET integrated database retrieval system