KEGG   Desulfovibrio magneticus: DMR_11650Help
Entry
DMR_11650         CDS       T00917                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00670  One carbon pool by folate
dma01100  Metabolic pathways
dma01120  Microbial metabolism in diverse environments
dma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DMR_11650 (folD)
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     DMR_11650 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     DMR_11650 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAH74656
NITE: DMR_11650
UniProt: C4XLR8
Position
complement(1286298..1287176)
Genome map
AA seq 292 aa AA seqDB search
MLLIDGKKVAAELRQRVKNDVDALVRQHGRAPHLAVILVGEDPASQIYVRYKEKACEEVG
FVSRIWRLDGGIGQCALEKLITELSSSEDIDGILLQLPLPKGLDAQRCLALVDPKKDVDG
FHPENVGRLSIGLPCLKPCTPFGVIKLLEYYGLSPAGKRAVVIGRSNIVGKPMAMLLSAA
SPFGNATVTVCHSRTPDLAAVVREADFIVPAIGKPKLITRDMVKPGAVIVDVGMNRLPDG
KLCGDVDYDNLTDVASAMTPVPGGVGPMTIATLMSNTVEAYRWRRQPPDCPI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttattgacggcaagaaagtcgcggccgaattgcgccagcgcgtgaaaaacgac
gtggacgccctggtgcgccagcacgggcgcgccccgcatctggccgtcatcctcgttggc
gaggacccggcttcccagatttacgtccgctacaaggaaaaggcctgcgaggaagtgggc
ttcgtttcccgcatctggcggctcgacggcggcatcggccagtgcgccctggagaagctc
atcaccgaactgtccagcagcgaggacattgacggcatcctgctccagctgcctctgccc
aagggtttggacgcccagcgctgtctggccctggtcgatcccaaaaaggacgtggacggc
ttccatcccgaaaacgtcgggcggctgtccatcgggttgccctgcctcaagccgtgcacg
ccgtttggagtcatcaagcttctggaatattacggcctttccccggccggcaagcgggcg
gtggtcatcgggcgcagcaacatcgtgggcaagcccatggccatgctgctctctgccgcc
tcgcctttcggcaacgccacggtgacggtgtgccattcgcgcacgccggacctggccgcc
gtggtgcgcgaggccgacttcatcgtgccggccatcggcaagcccaagctcatcacccgc
gacatggtcaagcccggcgcggtcatcgtggacgtgggcatgaaccgcctgcctgacggc
aagctgtgcggcgacgtggactacgacaacctcaccgacgtggcttcggccatgacgccg
gtgcccggcggcgtcggccccatgaccatcgccacgctcatgagcaacaccgtggaggcc
taccgctggcgtcgccagcccccagattgcccgatctag

DBGET integrated database retrieval system