KEGG   Desulfovibrio magneticus: DMR_15960Help
Entry
DMR_15960         CDS       T00917                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00564  Glycerophospholipid metabolism
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
Module
dma_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DMR_15960 (psd)
Enzymes [BR:dma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     DMR_15960 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: BAH75087
NITE: DMR_15960
UniProt: C4XPA6
Position
1763461..1764105
Genome map
AA seq 214 aa AA seqDB search
MYKPICGLARDGLPIIGVFALATLVFALLRWPCLATISLLSTIFSFNFFRDPDRTSPTEN
GIAVSPADGVVCKLGEAADPITGEMRQVVCVFMNVFNVHVNRSPVTGVVSEVRYIPGKFF
NASLDKASTDNERNVIVVTDAEGARFTVVQIAGLIARRIVCPAKAGDTLSRGERYGMIKF
GSRLDVYLPHGYHPAVAMGQKTMAGVTVLAKKAD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtataagcccatttgcggcctggcccgcgacggactgcccatcatcggcgttttcgcc
ctggcgaccctggttttcgccctgctgcgctggccttgcctagccaccatcagcctgttg
tccacgattttttccttcaatttcttccgcgacccggaccgcacctcgcccacggaaaac
ggcatagccgtgtccccggccgacggcgtggtctgcaagctcggcgaggcggcggacccg
atcacgggcgagatgcgccaggtcgtgtgcgtgttcatgaacgtttttaacgtccacgtg
aaccgctcgccggtcacgggcgtggtttcggaagtgcgctacattcccggcaaattcttc
aacgcttccctggacaaggcttccacggacaacgagcgcaacgtcattgtcgtcaccgat
gccgagggcgcgcggtttaccgtggtgcagatcgcggggctgattgcccggcgcatcgtc
tgcccggccaaggccggcgatacgctttcgcgcggcgaacggtacggcatgatcaagttc
gggtcgcgccttgacgtctatctgccccatggctatcatccggctgtcgccatgggccag
aaaaccatggccggtgtcaccgttttggcgaaaaaggccgactaa

DBGET integrated database retrieval system