KEGG   Desulfovibrio magneticus: DMR_18320Help
Entry
DMR_18320         CDS       T00917                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00010  Glycolysis / Gluconeogenesis
dma00051  Fructose and mannose metabolism
dma00562  Inositol phosphate metabolism
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01120  Microbial metabolism in diverse environments
dma01130  Biosynthesis of antibiotics
dma01200  Carbon metabolism
dma01230  Biosynthesis of amino acids
Module
dma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dma_M00002  Glycolysis, core module involving three-carbon compounds
dma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DMR_18320 (tpiA)
   00051 Fructose and mannose metabolism
    DMR_18320 (tpiA)
   00562 Inositol phosphate metabolism
    DMR_18320 (tpiA)
Enzymes [BR:dma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DMR_18320 (tpiA)
Exosome [BR:dma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DMR_18320 (tpiA)
  Exosomal proteins of bladder cancer cells
   DMR_18320 (tpiA)
  Exosomal proteins of melanoma cells
   DMR_18320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAH75323
NITE: DMR_18320
UniProt: C4XQF8
Position
2047417..2047923
Genome map
AA seq 168 aa AA seqDB search
MLLDAGCTYALAGHSERRHILGEDDAMVGRKVGFGLKSGLSMILCVGEKVEERKAGELEA
VLRRQIEAGLAEVGADVGPEKLAVAYEPVWAIGTGLTAGPEEVAEAHALVRAMLVERLGA
VGGQIRILYGGSVKQGNAGQLLGIDNVDGVLVGGASLEAGSFAAIVTA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggacgcgggttgcacctacgccctggccggccattccgagcgccgccatatc
ctgggcgaggacgacgccatggtcgggcgcaaggtgggttttgggctgaaaagcggcctg
tccatgatcctgtgcgtgggcgagaaggtggaggagcgcaaggccggcgaattggaagcc
gtgctgcgccgccagatcgaggccgggttggccgaggtcggggctgatgttgggccggaa
aagctggccgtggcctatgagccggtctgggctatcggtacggggctcacggccggaccg
gaggaagtggccgaggcccacgccctggtgcgggccatgttggtcgaacgattgggcgct
gtgggcggccaaatccgcattctctacggcggcagcgtgaagcagggcaacgcggggcag
ctattagggattgacaacgtcgacggagtgctggtaggtggcgcaagccttgaggctgga
agcttcgcggcgattgtgacagcttga

DBGET integrated database retrieval system