KEGG   Desulfovibrio magneticus: DMR_19490Help
Entry
DMR_19490         CDS       T00917                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00260  Glycine, serine and threonine metabolism
dma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01130  Biosynthesis of antibiotics
dma01230  Biosynthesis of amino acids
Module
dma_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DMR_19490 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DMR_19490 (trpB)
Enzymes [BR:dma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DMR_19490 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peptidase_C14 TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: BAH75440
NITE: DMR_19490
UniProt: C4XR95
Position
2184154..2185509
Genome map
AA seq 451 aa AA seqDB search
MENCMEMKINLPEAEMPTQWYNALPDLPTPLAPPLDPQTKEPVTPEQLEVIFPKAVIEQE
MSPQRWLPIPQPVLDVYRLYRPTPLVRAKRLEEALGVKCKIYYKNESVSPAGSHKPNTAI
PQAYYNKAEGVRRLATETGAGQWGTALSFACSMLDMECTVYMVKVSYDQKPYRRILINAY
GGEVFASPSPRTQTGRAMLESDPDCTGSLGLAISEAVEDAATHADTKYALGSVLNHVLHH
QTIIGLEVEKQLAMVGDKPDYLVGCVGGGSNFAGLVLPFLPRKLAGEAIEFIAVEPQACP
TLTKGQFRYDYGDVAKLTPLLKMHTLGHAFMPAPIHAGGLRYHGDAPIVCNLAAEGLVNA
QAYYQTECFEAAKLFLRTEGFLPAPETSHAIKGAIETAKKAKPGESVVFLYSGHGLLDLA
SYDAFLQGKLSDFAYPEEHIAEALKACPTVG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtggagaattgcatggagatgaagatcaatctgcctgaggcggagatgccgacgcagtgg
tataacgccctgcccgatctgcccacgcccctggcgccgccccttgatcctcagaccaag
gagcccgtgacccccgaacagctggaagtcatcttccccaaggccgtcatcgaacaggaa
atgtcgccgcagcgttggctgcccattccccagccggtgcttgacgtctaccgcctctac
cggcccaccccccttgtgcgcgccaagcgtctggaagaagctctcggggtcaagtgcaag
atctattataaaaacgaatccgtttcgccggccggctcccacaagcccaacaccgccatc
ccccaggcctattacaacaaggccgaaggcgtgcgccggctggccaccgaaaccggggcc
ggccagtggggcacggccctgtctttcgcctgttccatgctggacatggaatgcacggtc
tatatggtgaaggtgagctacgaccagaaaccgtatcggcgcatcctcatcaacgcctac
ggcggcgaagtctttgcctcgccctccccgcgcacccagaccggccgggccatgctcgaa
agcgaccccgattgcaccggttcgctggggctggccatctccgaagccgtggaagacgcc
gccacccacgccgacaccaagtacgccctgggcagcgtgctcaaccacgtgctgcaccat
cagaccatcatcggtcttgaagtcgagaagcaactggccatggtcggcgacaagccggat
tacctggtcggctgcgtgggcggcggcagcaacttcgccggcctggtcctgccgtttttg
ccgcgaaagctggccggcgaggccatcgagttcatcgccgtggagccgcaagcctgcccg
accctgaccaaggggcagttccgctacgactacggcgacgtggccaagctcacgcccctg
ctcaagatgcacaccctcggccacgccttcatgccggcccccatccatgccggcgggctg
cgctaccacggcgacgcgcccatcgtgtgcaatctggccgccgaagggttggtgaacgcc
caggcctactaccagaccgagtgtttcgaggcagccaagctgttcctgcgcaccgagggc
tttctgcccgcgccggagacctcccatgccatcaagggcgccatcgagaccgccaagaag
gccaagcccggcgagtcggtggtgttcctctattccggccatggcctcctcgatctggcg
tcctacgacgcctttttgcagggcaaactctccgacttcgcctatcccgaagagcatatc
gccgaggctctcaaggcctgcccgaccgtcgggtaa

DBGET integrated database retrieval system