KEGG   Desulfovibrio magneticus: DMR_26970Help
Entry
DMR_26970         CDS       T00917                                 

Definition
(GenBank) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00630  Glyoxylate and dicarboxylate metabolism
dma01100  Metabolic pathways
dma01110  Biosynthesis of secondary metabolites
dma01120  Microbial metabolism in diverse environments
dma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dma00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DMR_26970
Enzymes [BR:dma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     DMR_26970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAH76188
NITE: DMR_26970
UniProt: C4XGN0
Position
3017870..3018667
Genome map
AA seq 265 aa AA seqDB search
MGVLRAGGPSAAGVCFGSRLGSTKTDAKIVQQGHQTPWGTFNKLKIKGKIFGTKSAFFLK
QTGKHCITRNTLPRSPHMNLTLTISGACCDLALHPVNAETAARVCMLGDNLYKTNSIEWW
RANSNNTCGMRLTADARIEAALDGASVAFDISRMSASAALLTQRPFLESPEKSLCLLGYD
DEACSRTWTWRNVTDYDMSRFEFFVQRWDAILGVADYLVIDDVCYDGRPADEAVWGESEG
FTFRTPLIVPASAARELAAAPRRAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggggttctccgcgccggcgggccgagcgcggccggagtgtgcttcggaagccgtttg
gggtcaaccaaaacggacgcaaaaatcgtccaacagggtcaccaaaccccctggggaact
tttaacaaactaaaaataaaaggaaaaatattcggcacgaaaagtgctttttttctcaaa
caaacgggcaagcactgcatcacccgaaatactctcccaaggagtccccatatgaacctg
accctgaccatctccggcgcctgctgcgatctggcccttcatccggtgaacgccgaaacc
gccgcccgcgtctgcatgctcggcgacaacctctacaagaccaactccatcgagtggtgg
cgcgccaacagtaacaacacctgcggcatgcgcctgaccgccgatgcgcgcatcgaagcc
gccctggacggcgcttccgtggcctttgacatctcccgcatgagcgcgtccgccgccttg
ctcacccagcggcccttcctggagagtccggaaaagagcctgtgcctgctcggttacgac
gacgaggcctgctcgcgcacctggacctggcgcaacgtcaccgactacgacatgagccgc
ttcgaatttttcgtccagcgctgggacgccatcctcggcgtggccgactacctcgtcatc
gacgacgtctgctacgacggccggccggccgatgaagccgtctggggcgaaagcgaaggc
ttcaccttccgcacgccgctcatcgtgcccgccagcgccgcccgagaactcgccgcggcg
ccgcgacgcgccgcgtag

DBGET integrated database retrieval system