KEGG   Desulfovibrio magneticus: DMR_29670Help
Entry
DMR_29670         CDS       T00917                                 

Definition
(GenBank) oxidoreductase
  KO
K00394  adenylylsulfate reductase, subunit A [EC:1.8.99.2]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00920  Sulfur metabolism
dma01100  Metabolic pathways
dma01120  Microbial metabolism in diverse environments
Module
dma_M00596  Dissimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    DMR_29670
Enzymes [BR:dma01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With unknown physiological acceptors
    1.8.99.2  adenylyl-sulfate reductase
     DMR_29670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 DAO FAD_oxidored Thi4 Succ_DH_flav_C Pyr_redox_2 Lycopene_cycl HI0933_like GIDA Trp_halogenase NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: BAH76458
NITE: DMR_29670
UniProt: C4XHU0
Position
3362070..3363827
Genome map
AA seq 585 aa AA seqDB search
MPRMAPNPPSLDAVETVCVDCDVLIIGGGNAGCFSAVEAAKLDPTLKVVIMEKAHIMRSG
ACSAGMDAINTYIPEGKTPEDLVRWCRSQVGGGPIREDLALSNARELNESVDDLERWGLP
ILRDENGNIRYRGAWDISIHGEQLKPIMAEKAIEAGAEVYNRVACTQLLMDGNRCIGALG
FGVRDGKFYVFRAKATINATGGAAGLYKSYTADATDAHHQIWMCPYCVGTGYAVGIRQGA
EMTSMEQRWVATRTKDFCGPVDTISVGYKAPIINAKGERIMQSRYAHLGADKAPRYIRAN
APMEEWLAGRGPTYCDTRGMAPELAQQMMTDYLNERPSFVLFLASRGQDPVKEPIEIYGS
DPYIVGGHTQSGFWVDMERMTTIPGLFAAGETAGGNPNKFVGGCAAEGKLALRGAAAYIA
GLELPEPDAAQVDAEKARVFAPLLRGEAFDGLRALEMEERLQRLMDEYAGGTSQFYRTNE
ERLDYALKHLAMLRSQVQYLKAGDLHDLMAVHEVIDRIDVAEVLCHHLRFRKETRWQGWQ
TRSDYPEVDPAYDCHVESRKNLATGEIETFTRPYEQIVAGDRYKP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcatggcccccaatccccccagtcttgacgccgtggaaaccgtctgcgtggac
tgcgatgtcctcatcatcggcggcggcaacgccggctgcttctcggccgtggaagcggcc
aagctcgaccccaccctcaaggtggtcatcatggaaaaggcccacatcatgcgctccggt
gcctgctctgccggcatggacgccatcaacacctacatccccgaaggcaagaccccggaa
gacctggtgcgctggtgccgctcccaggtcggcggcggccccatccgcgaggatctggcc
ctgtccaacgcccgggaactcaacgagtccgtggacgacctggagcgctggggcctgccc
atcctgcgcgacgaaaatggcaacatccgctaccggggagcctgggacatctccatccac
ggcgagcagttaaagcccatcatggccgagaaggccatcgaggccggggccgaggtgtat
aaccgcgtagcctgcacccagctcctcatggacggcaaccgctgcatcggggccctgggc
tttggcgtgcgcgacggcaagttctacgtgtttcgggccaaggccaccatcaacgccacc
ggcggcgcggccggcctgtataaaagctacaccgccgacgccaccgacgcccaccaccag
atctggatgtgcccctactgcgtgggcacgggctatgccgtgggcatccgccagggcgcg
gaaatgacctccatggagcagcgctgggtggccacccgcaccaaggacttctgcggtccg
gtggacaccatctcggtgggctacaaggccccgatcatcaacgccaagggcgagcgcatc
atgcaaagccgctacgcccacctgggcgcggacaaggccccccgctacatccgggccaac
gcgcccatggaagagtggctggccgggcgcggccccacctactgcgacacgcgcggcatg
gccccggaactggctcagcagatgatgacggattatttgaacgagcgtccgagcttcgtg
ctcttcctggccagccggggccaggacccggtcaaggaacccatcgagatctacggctcc
gacccctacatcgtcggcggccacacccagtcgggcttttgggtcgacatggagcgcatg
accaccatcccgggcctgttcgcggccggcgagacggccggcggcaaccccaacaagttc
gtgggcggctgcgccgccgagggcaagctggccctgcgcggcgcggcggcctacatcgcg
ggcctggaactgcccgagcccgacgccgcccaggtagacgccgaaaaagcccgggtgttc
gccccgcttttgcgcggcgaggccttcgacggtctgcgcgccctggagatggaagagcgc
ctgcagcggcttatggacgaatacgccggcggcaccagccagttctaccgcaccaacgaa
gagcgcctggactatgcgctcaagcacctggccatgctgcgcagccaggtccagtacctc
aaagccggggatctccacgacctcatggccgtgcacgaggtcatcgaccgcatcgacgtg
gccgaggtgctgtgccaccacctgcgcttccgcaaggagacccgctggcagggctggcag
acccgttcggactatcccgaggtcgatccggcctacgactgccatgtggaaagccgcaag
aacctggccaccggcgagatcgagaccttcacccgcccctacgagcaaatcgttgcgggc
gaccgctacaagccctaa

DBGET integrated database retrieval system