KEGG   Desulfovibrio magneticus: DMR_38190Help
Entry
DMR_38190         CDS       T00917                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
dma  Desulfovibrio magneticus
Pathway
dma00520  Amino sugar and nucleotide sugar metabolism
dma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DMR_38190
Enzymes [BR:dma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     DMR_38190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 3Beta_HSD adh_short DUF1416 KR
Motif
Other DBs
NCBI-ProteinID: BAH77310
NITE: DMR_38190
UniProt: C4XN07
Position
complement(4324756..4325706)
Genome map
AA seq 316 aa AA seqDB search
MHLKKRVLVTGGAGFLGSHLCERLLAQGCDVICLDNYFTGSKQNVAHLLDNPNFELMRHD
VTFPLYVEVDEIYNLACPASPIHYQHDPVATTKTSVHGAINMLGLAKRLRAKIMQASTSE
VYGDPSVHPQPESYWGNVNPIGFRSCYDEGKRCAETLFFDYRRQHNLRIKVARIFNTYGP
RMHPNDGRVVSNFIIQALRGEPLTVYGQGQQTRSFCYVDDLVEAFLRLMDTPDDFTGPVN
TGNPGEFTILELAKLVIEYTGSKSIIDYRPLPQDDPKQRRPDITLAKAKLGWEPKVALPE
GLKKTIEYFDAFLRQA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgaaaaaacgtgttctcgtcaccggcggcgccggctttctcggttcgcacctg
tgcgaacgcctgctcgcccagggttgcgacgtcatctgcctggacaactatttcaccggc
tccaagcaaaacgtcgcgcatctcctcgacaatccgaacttcgagctgatgcgccacgac
gtcaccttccccctctacgtggaagtcgacgagatctacaacctggcctgtccggcctcg
cccatccactaccagcacgacccggtggccaccaccaagaccagcgtgcatggcgccatc
aacatgctcggcctggccaagcgcctgcgggccaagatcatgcaggcctccacttccgag
gtctacggcgacccgtcggtgcatccccagcccgaatcctactggggcaacgtcaacccc
atcggtttccgctcctgctacgacgaaggcaagcgctgcgccgaaaccttgttcttcgac
taccgccgtcagcacaacctgcgcatcaaagtcgcccgcatcttcaatacctacgggccg
agaatgcatcccaacgacggccgcgttgtctccaacttcatcatccaggctttgcgcggc
gagccgctgaccgtctacggccagggccagcagacccggtcgttttgctatgttgacgac
ctcgtcgaagccttcctgcgcctcatggatacccccgacgacttcaccggcccggtcaac
accggcaacccgggcgaattcaccatactggaactggccaagctggtcatcgaatacacc
ggctccaagtcgatcatcgactaccgccccctgccccaggacgatcccaaacagcgccgc
ccggacatcaccctggccaaggccaagcttggttgggaacccaaggttgccctgcccgag
ggccttaaaaagaccatcgaatacttcgatgccttcctgcgccaggcctaa

DBGET integrated database retrieval system