KEGG   Dehalococcoides mccartyi BTF08: btf_1084Help
Entry
btf_1084          CDS       T02475                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dmc  Dehalococcoides mccartyi BTF08
Pathway
dmc00790  Folate biosynthesis
dmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    btf_1084 (folE)
Enzymes [BR:dmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     btf_1084 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI FolB
Motif
Other DBs
NCBI-ProteinID: AGG08160
Position
complement(1004888..1005457)
Genome map
AA seq 189 aa AA seqDB search
MFDEQAIKQSVQNILVAIGEDPDREGLKETPRRVAQMYTELFSGMNQDPAEVLRVGYELG
HREMVIIKDIPFYSMCEHHLLPFSGVVHIGYIPNIDGRVVGISKLARVVEIYAKRPQIQE
RMATQIADAIMDGLKCDGVAVVIEAEHMCMVMRGIKKPGSRVITSALRGSFHKSPAARAE
FLSLIQHKG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaacaggcaataaaacagtcggtacaaaatattctggtagctattggcgaa
gacccggatagggaggggctcaaagaaactcccagacgggtagcccagatgtatactgag
ctgttttcaggtatgaaccaagacccggcagaagttttgcgggttggatacgaacttggc
caccgcgagatggttattataaaagatatacctttttactctatgtgcgagcatcacctt
ctgcccttttcgggggtagtccatataggttatatccccaacattgacgggcgggtagta
ggaataagcaagcttgccagagtggttgaaatttatgccaaacgcccccagatacaggaa
cgcatggccacccagattgcggacgctattatggacgggcttaaatgtgacggagtggcc
gtagtgatagaggccgaacacatgtgcatggtgatgcggggcatcaaaaagcccggcagc
cgggtgataacctcggcacttcgtggcagtttccataagtcacccgctgccagagcagag
tttctttcgcttatccagcacaagggctaa

DBGET integrated database retrieval system