KEGG   Dehalococcoides mccartyi BTF08: btf_112Help
Entry
btf_112           CDS       T02475                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dmc  Dehalococcoides mccartyi BTF08
Pathway
dmc00260  Glycine, serine and threonine metabolism
dmc01100  Metabolic pathways
dmc01110  Biosynthesis of secondary metabolites
dmc01120  Microbial metabolism in diverse environments
dmc01130  Biosynthesis of antibiotics
dmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    btf_112
Enzymes [BR:dmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     btf_112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGG07222
Position
114177..115211
Genome map
AA seq 344 aa AA seqDB search
MKIIDLRSDTVTRPTPEMKKAMCDAPLGDDVFGEDPTVNRLEKMAAGKTGKEAALFTPSG
TMSNLLSVLSQTRPGDEIILGSEAHILWYEVGGASAVGGVVMRAVPNQPDGTIYLADIKD
AIRGSNLHFPPTRLICLENTHNRCGGAVLSPSYTAGVANLARMRGIKVHLDGARLFNACV
ALGVSAKELCQGMDTVSFCLSKGLSAPAGSLLCSDQETINRARKFRKMLGGGMRQAGVLA
ACGIVALETMIERLALDHAMAKTLAEGLFDIDNHTLDKQIVQTNIVIFNPPFGLGADEFL
EQAKQAGLLFTMGSHGRVRAVCHHDLSEADIQTALRRIAAMKKA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatagaccttcggagtgatactgttacccgtcccacccccgaaatgaaaaaa
gccatgtgcgatgcccctctgggagatgacgtgtttggggaagatcccactgtaaaccgt
ctggagaaaatggcagccgggaaaacgggtaaagaggccgctttgtttacccccagcggc
accatgagtaatctgctttcagtcctgtcccagacccgcccgggtgatgaaataatactg
gggagtgaagcccatatactctggtacgaagtaggcggggcatcagcagtgggaggtgtg
gttatgcgggctgtgccaaaccaacctgacggcactatctatctggcagatataaaagat
gctatacgcggctcaaatcttcattttccgcctacacggcttatctgtctggaaaatacc
cacaaccgttgcgggggtgcggtgctaagcccgtcctacaccgccggggtggcaaatctg
gccagaatgcggggtattaaggtccatctggacggtgcccgtttgttcaatgcctgtgtg
gctctgggtgtttcagccaaggaactctgtcaggggatggatacagtcagtttttgcctt
tcaaaagggctgtcggcaccggcaggatcacttttgtgttctgaccaagaaaccataaac
cgggccagaaaattccgcaagatgctgggcggaggcatgcgtcaggcaggggtattggca
gcctgcggtattgtggcgctggaaactatgatagagcgcttggctctggatcacgctatg
gctaaaactctggcggaaggtctgtttgatatagataaccatacgctggataaacaaatt
gtccaaaccaatattgtcattttcaacccgccgtttggtcttggcgctgacgaattttta
gagcaggccaaacaggccgggttactctttaccatgggtagtcacggccgggtcagggct
gtttgccaccatgacctgagcgaggcagatatacaaacagcccttaggcgtattgccgct
atgaaaaaggcttaa

DBGET integrated database retrieval system