KEGG   Dehalococcoides mccartyi BTF08: btf_32Help
Entry
btf_32            CDS       T02475                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dmc  Dehalococcoides mccartyi BTF08
Brite
KEGG Orthology (KO) [BR:dmc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    btf_32
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AGG07145
Position
30421..31422
Genome map
AA seq 333 aa AA seqDB search
MPDASFLPYLLIILLAIGFAFVNGTNDTANAIATVVGTRVLSPRKAIIMAAVANLVGVFT
GTAVARTIGKGILGPESLTYETVIAGLVAAVIWSVVATRKGLPVSLTHCLVAGLAMAGVA
MAGFGSVDWGILLKIIAAVGIAPIMGMAGGYLLMVALLWIFRRSVPSKTNGLFSHLQIFS
AAFMAFSHGRSDGQMPMGIIALGTVLYTGNAGLWDAIPFWIIVLSALSISAGTAIGGWKV
IQTVGVRMTNLRPINGFAAETAAATVIQIAASIGIPVSSTHAISSAIMGVGATRRLSAVR
WGVAGNIVGAWLLTFPICGVLGFLVAGLFKLIF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgcctcgtttttaccttatcttcttattatccttttagccataggttttgcc
tttgtaaacggtaccaacgacacagctaatgccattgccaccgtggttggtacgcgtgtt
ttgtctccccgcaaggctataataatggcggcggttgccaatcttgtgggtgtttttacc
ggtacagctgtggccagaactattggcaagggcatactgggacctgaatcacttacctat
gaaacagttattgccggacttgtagccgcagttatctggtctgtggtggctacccgtaag
gggcttcccgtaagtctgacgcactgtctggtggccggtctggccatggccggtgtggct
atggcggggtttggatcggtagattggggtattcttttaaagattattgcggctgtaggt
attgcccctattatgggtatggcaggtggttacctgcttatggttgccttgctttggata
ttcagacggagtgttccctccaagactaatgggcttttttcccaccttcaaatattttca
gccgctttcatggctttcagccacgggcggagtgacgggcagatgcctatgggtattatt
gctctgggtacagtgctttataccggtaatgccggtctctgggacgctataccgttttgg
attattgttctttcggctttgtctatcagcgcagggacggctatcggcggttggaaggtt
atccagacagtgggcgtgcgtatgactaaccttaggccgataaatggttttgcggctgaa
actgctgccgctacagttatccagatagcggcttcaataggtattcctgtgtcaagcacc
catgccatttcttcggctattatgggggtgggagctacccgcaggctttctgcagtacgc
tggggtgtggcgggaaatattgtgggggcgtggctgcttacatttcctatttgcggtgtg
ctgggctttctggtggctggtttgtttaaacttattttctaa

DBGET integrated database retrieval system