KEGG   Dehalococcoides mccartyi BTF08: btf_81Help
Entry
btf_81            CDS       T02475                                 

Gene name
pycA
Definition
(GenBank) pyruvate carboxyl transferase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
dmc  Dehalococcoides mccartyi BTF08
Pathway
dmc00020  Citrate cycle (TCA cycle)
dmc00620  Pyruvate metabolism
dmc01100  Metabolic pathways
dmc01120  Microbial metabolism in diverse environments
dmc01200  Carbon metabolism
dmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    btf_81 (pycA)
   00620 Pyruvate metabolism
    btf_81 (pycA)
Enzymes [BR:dmc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     btf_81 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGG07191
Position
83790..85286
Genome map
AA seq 498 aa AA seqDB search
MLNKILVANRGEIAIRVMRACRELGIKTVAVYSDADKGALFVKYADEAYHIGPSQLSESY
LNIKKIVAVAKKSGVDGVHPGYGFLSENPGFALALEKAGIKFIGPSSRVIELMGNKIAAR
REMKKAGVPVLPGTEGCVSGIEQATEAAAAIGYPVIIKPSGGGGGIGMRVANGPDELKDA
IESSQKVAGNTFGLAEVYIEKYISNPRHIEIQIMGDSQGNIVYLGERECSIQRRYQKLIE
ESPSPVITPELRKKMGEVAVKAGKWVNYEGAGTIEFIFSNGQFYFLEANTRVQVEHPVTE
MVTGIDIVKEQIMVASGSELSFKQEEVEMRGWAIECRINAEDPLNEFAPSAAKLKGYRSP
GGIGVRVDSGVHTRYNIPYLYDPMISKLIVWGRTREEAIARMRRALYEYIIVGVKTNIPF
HKAVMVNPNFVAGNLHTHFIEKETTLLDEMKRIMSEEQPLEEKLSEIFDDTRRIAAIAAV
TALTQLPAEIDEDEITGV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacaagatactggtcgccaaccggggtgaaatagctatacgggtcatgcgtgcc
tgccgtgagctgggtattaaaacagtagcggtttattccgatgcagataaaggtgctctg
tttgtaaagtatgctgatgaagcttatcatatcggcccttcccagctgtccgagagctac
ctgaatattaaaaagatagtggctgtggccaaaaaatcaggcgtagacggggttcatccc
ggatacggctttttatctgaaaatcccggttttgctctggctctggaaaaagccggaatt
aaatttataggtccaagtagccgggttatagaactgatgggcaacaagattgccgccagg
cgtgagatgaaaaaggcgggtgtgccggtactgcccggtacggagggctgtgtttcaggt
attgaacaggccaccgaggcggcagcggctatcggctatccggttattataaaacccagc
ggcggcggcggtggtatcggcatgcgggtggctaacggcccggatgaacttaaagatgct
atagagtcttctcagaaagtggccggcaacacctttggtctggccgaagtgtatattgaa
aaatacatatccaatccccgccatatagaaatacagataatgggtgattcacagggcaac
atagtttatctgggtgagcgggaatgttctatccagcggcgttatcagaaactcatcgaa
gaatccccttcccccgttattacccctgagcttcgcaagaagatgggcgaagtggcggta
aaggccggtaaatgggttaactatgaaggtgccggcactattgaatttattttttcaaac
gggcagttctatttccttgaggccaatacccgtgtacaggtagaacaccctgttaccgaa
atggtaacaggcatagatatagtcaaagaacagataatggtagcttccggcagtgagctt
tcattcaaacaggaagaagttgagatgcggggctgggctatagagtgccgtatcaatgcc
gaagatcccttgaacgagtttgctccctcggctgccaagctcaaaggctatcgttcaccc
ggcggtatcggagtccgggtggatagcggtgttcatacccgctataacataccctatctg
tatgaccccatgatatccaagctgattgtttggggacgcacccgcgaagaagccatagcc
cgcatgcggcgtgccctgtacgaatacatcatagtaggggtaaagaccaatattcctttc
cataaggcggttatggttaaccctaactttgtagccggcaatctgcatactcatttcatt
gagaaggaaactaccctgttggatgaaatgaaacgcattatgagtgaagaacagcctctg
gaagagaagctgtccgagatatttgacgatacccggcggattgccgctattgcggcggtc
actgccctgacccagttgccggctgaaattgacgaagatgagataaccggcgtttaa

DBGET integrated database retrieval system