KEGG   Dehalococcoides mccartyi DCMB5: dcmb_667Help
Entry
dcmb_667          CDS       T02476                                 

Gene name
acsC
Definition
(GenBank) acetyl-CoA synthase, corrinoid iron-sulfur protein, large subunit
  KO
K00197  acetyl-CoA decarbonylase/synthase, CODH/ACS complex subunit gamma [EC:2.1.1.245]
Organism
dmd  Dehalococcoides mccartyi DCMB5
Pathway
dmd00680  Methane metabolism
dmd01100  Metabolic pathways
dmd01120  Microbial metabolism in diverse environments
dmd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmd00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    dcmb_667 (acsC)
Enzymes [BR:dmd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.245  5-methyltetrahydrosarcinapterin:corrinoid/iron-sulfur protein Co-methyltransferase
     dcmb_667 (acsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CdhD FeS TRCF
Motif
Other DBs
NCBI-ProteinID: AGG06294
Position
complement(654051..655397)
Genome map
AA seq 448 aa AA seqDB search
MSPTGIEIYKFLPRTNCGECGVPTCLAFAMSLAGGRAELSSCPYVSEETKLKLEEASAPP
VRTVSIGTGIYSFKIGGETVMHRHEKRFEHQSGIALLLSDNLTETEQNTKLTAFNSFQYK
RVGAILKPDMLALRADSGSSEKYLKLVKLAAEKCQASLMLICANTTVLDESLKICAERKP
LLHAATAENSNEMAELAKKYNCPLVAKAKNLTDLAELTIKLQSLGIKDIVLDSSPASFKQ
TLADNIAIRRAAILKKFRPLGFPVINFPCLITSDHMKESLFASILTAKYAGILVLSDFRG
ETLFPLLVARMNLYTDPQRPLATTEGIYEINNPDANSPVMLTCNFSLTYFIVAGEMETSR
VPCYLLIKDTEGLSVMTAWAAGKFGADTIGKFVKNSGIAGKVNHRKLIIPGYASMESGGL
EEELSGWEIMVGPREAAHIPAYLKQFKP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctaccggtatagaaatttataagtttttaccccgaaccaactgcggtgaatgc
ggcgtgcccacctgtctggcatttgccatgagtctggcaggcggcagagctgaactttct
tcctgcccttacgtttcagaagaaaccaaactgaaactggaagaagcttctgcacccccg
gtcagaaccgtaagcataggtacaggtatatactcctttaagataggtggcgaaactgtc
atgcaccgccatgagaagcggtttgagcaccaatccggcattgccctgctactctcagac
aatctgaccgaaaccgagcagaacaccaaactgaccgctttcaacagctttcagtacaaa
cgggtaggtgctattttgaagccggatatgctggcactcagggcagacagcggttcaagt
gaaaaatacctaaaactggtcaaacttgccgccgaaaaatgccaagccagcctaatgctg
atatgtgcgaataccactgtgcttgatgaatccttaaagatttgcgctgaacgcaaaccc
cttcttcatgccgctactgcggaaaacagcaacgaaatggcagagctggctaaaaaatac
aactgcccgctagtagccaaagcgaaaaacctgacagacctggctgaacttaccatcaaa
ctccaatcactgggtattaaagatattgtgcttgacagctctcccgccagctttaaacaa
accttagccgacaatatcgccattcggcgggcagccattttgaagaaattccgtcctttg
ggctttccggttattaatttcccctgcctgataacttcagaccacatgaaggagtctctg
tttgccagcatactgaccgccaaatatgcgggtatactggtgctgtctgacttcaggggt
gaaaccctgttccctttgctggtagcacgtatgaacctttataccgaccctcagcgtccc
ttagctaccaccgagggtatctatgaaataaataatcctgatgccaattcgccggtcatg
ctcacctgcaacttctcgctgacatattttatcgttgccggtgaaatggaaaccagccgc
gtgccgtgttacctgctgataaaagataccgaagggctttcggttatgactgcctgggca
gccggcaaattcggggcagataccataggcaaatttgtaaaaaacagcggcattgccggg
aaggtcaatcaccgcaaactgattatccccgggtatgcctctatggaaagcggcggtctg
gaagaagaactatccggctgggagataatggttggtccgcgtgaagccgcccatataccg
gcttatttaaagcagtttaaaccctaa

DBGET integrated database retrieval system