KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10198
Entry
Dmel_CG10198      CDS       T00030                                 

Gene name
Nup98-96
Definition
(RefSeq) nucleoporin 98-96kD, isoform D
  KO
K14297  nuclear pore complex protein Nup98-Nup96
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    Dmel_CG10198 (Nup98-96)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG10198 (Nup98-96)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG10198 (Nup98-96)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dmel_CG10198 (Nup98-96)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dmel_CG10198 (Nup98-96)
SSDB
Motif
Pfam: Nup96 Nucleoporin2 Nucleoporin_FG
Other DBs
NCBI-GeneID: 42816
NCBI-ProteinID: NP_001262885
FlyBase: FBgn0039120
UniProt: Q9VCH5
Position
3R
AA seq 1960 aa
MFGGAKPSFGATPAATSFGGFSGTTTTTPFGQSAFGKPAAPAFGNTSTFAAQPAQQSLFG
AAATPAQPAGGLFGANTSTGFGSTATAQPTAFGAFSQPQQTSNIFGSTQTAASTSLFGQS
TLPAFGAAKPTMTAFGQTAAAQPTGSLFGQPAAATSTTGFGGFGTSAPTTTNVFGSGTAS
AFAQPQATAVGASGVNTGTAVAKYQPTIGTDTLMKSGQANSVNTKQHCITAMKEFEGKSL
EELRLEDYMCGRKGPQAGNAPGAFGFGAQVTQPAQPASGGLFGSTAQPSTGLFGQTVTEN
KSMFGTTAFGQQPATNNAFGAATQQNNFLQKPFGATTTTPFAAPAADASNPFGAKPAFGQ
GGSLFGQAPATSAAPAFGQTNTGFGGFGTTAGATQQSTLFGATPAADPNKSAFGLGTAAS
AATTGFGFGAPATSTAGGGLFGNKPATSFAAPTFGATSTASTPFSNFGLNTSTAATGGGL
FNSGLNKPATSGFGGFGATSAAPLNFNAGNTGGSLFGNTAKPGGGLFGGGTTTLGGTGAA
PTGGLFGGGTTSFGGVGGSLGGGGFGMGTNNSLTGGIMGAQPTLGIMTPSHQPIHQQILA
RVTSPYGDSPIFKDLKLSSEADATRATNPAAQQAVLDLTSNQYKISTSNNPAPMKVKALG
STLNRKSLFDGLEEFDASVEGFNLKPSAKRLVIKPKVKSVEGGNPSSSIGSAPNTPQSRP
KGATPNKERESFSGAIPSEPLPPAGNSPGATNGRESQDNGRRESWLHPNNLEKVRQHNIQ
TGMDQGSPHNSTLNELVPRKPLDTYRPSSTVRLSVSTIPENPFEDQSSTIARRETFTSQQ
ANESVLSNRSNEAEDSAANQSRLAIEAAAAEAADDESHPTGIVLRRVGYYTIPSLDDLRS
YLAEDGSCVVPNFTVGREGYGNVFFGKEMDVAGLNLDEIVHFRNKEIIIYPDDENKPPIG
QGLNRDAQVTLDQVWPLDKTKHEAIKDPQRLLEMDWEGKLRRVCDKNDTRFIEYRPETGS
WVFRVKHFSKYGLGDSDEEDELPTDPKKAKIATLEAQQRANAEKMTLNSLRQAQKISEDA
ARNLDPKALVAGVASGFRPMDDTAEFLLMDKTQFFQAGGNSDFSMFDPPRQRPTITSPTA
VLAQEMVGNEAHKMQLMKSSFFVEDNAPEDEPMETTGRLLRHRKFFNVEPLVWKDGASES
SSQYDFEHPSPALPISSSVSEASLMCDAHYEETSSMATGSIVAAVKETKFEMPVTKAFKF
VCKPKVAPIKLRATTVPLPRSIAYEMRDNWIADLGFYKGRSFKLSFGPQNSLVLPSTYNN
MQNLKEFTGPSLPVSMVFAPRSATDLSPSVMQLVEFNMVKGNEGFRESIIPHLEVQLNDC
LSVNVEGSECPCIHPDSGTKLVSKHFSESLKQRNAGLKEDYSVSVWSLLFALWGDHDELV
DLEKNSHYMVMCRRNLLSEWLENTLLGKDLLSKKVSTHSYLEHMLDLLSCHRVNEACELA
FSYDDANLALVLSQLSSGAVFRLLMEEQLFAWQQSKSDKYIDLERLKMYMLAAGAPMMQS
SHGAINLLENKNWLTALALQLWYFTAPTSSITDALNAYNDAFQAEECYAEPPKPSYRDAP
TDTKKPVYDLRYHLLQLHSKRMHSLEETLNPITHTADAMDFRLSWLLLQTLRALGYRHCS
PLTEARLSVDFASQLENEGLWQWGIFVLLHIKQQTQRERAVQQMLQRNVSVSAKVALYAE
ERFIVEELGIPMSWVDYAKAVKAGASGKHHLQAKYLLKAKHFATAHDVIFQHIAPDAIIN
GKMKYLHSLLIQFEDTEGSSIRVPNWANQGQIFLDFIDISAKFKQIRSVTNIADINARWE
NLKPQLSELCSRISLLPCPTSKHRLCQSEISQSLSCLVHGMCIVCPEMESSTVLKVALER
LPLPQEFASKELRIWLEELLDKIQNEPPFSERQQPTMMEI
NT seq 5883 nt   +upstreamnt  +downstreamnt
atgtttggcggcgcgaaacccagcttcggagccactccggcggccaccagctttggcgga
ttcagcggcaccacaacaaccactccgtttggccagtcggcatttggcaaacccgccgca
ccggcctttggaaacacctccacctttgccgcccaacccgcgcagcagtcactgttcggt
gcggcagccacaccagctcagcccgccggaggcttattcggggcaaacacgtccacggga
tttggaagcactgccacagctcagcccacggcttttggagccttctcgcagccgcaacag
acctcgaacatatttggatccacccagacggcggcaagcacctccctctttggacaatcg
acgctacccgcctttggagccgccaagccgactatgacggcctttgggcaaacagctgct
gctcagcccacgggctctttgtttggccaaccggctgccgccaccagtacaacaggattc
ggaggctttgggacgtcggcgcctacaaccaccaatgtttttggcagtggcaccgcctcc
gcctttgcccaacctcaggctacggccgtgggagcttccggagtcaatacgggcacggcc
gtggccaagtaccagccaaccattggtacagataccctgatgaagagcggtcaggcaaat
agtgtgaacactaagcagcactgcatcacggctatgaaggagttcgagggcaaatctctg
gaggagctccgcctggaagactatatgtgcgggcgcaagggtccacaggctgggaatgct
ccgggagcttttggatttggagctcaggttactcagcccgctcagcctgcaagtggtggc
ctgtttggaagcactgcccaaccaagcacaggtctgtttggccaaactgtgaccgagaat
aagagcatgtttggcaccaccgcttttggccaacaaccggcgactaacaatgcattcgga
gcagcaacccagcaaaacaactttctgcaaaagccctttggagccaccaccaccactccg
tttgccgctcccgcagctgacgcttcaaatccatttggggcgaagcctgcttttggacag
ggaggaagcctctttggtcaggcacctgctaccagtgcggctcctgctttcggacagact
aacacaggattcggaggctttggaaccacagccggagcaacgcaacagtcaactcttttt
ggtgccacaccagccgccgatccaaataaatcagcctttgggttgggaacggctgcatca
gcagccacgacaggttttggatttggagctccagcaacaagcaccgccggcggaggcctt
ttcggaaacaagcccgccactagctttgctgctccaactttcggcgcaacctccacggct
agcactccgttttcaaattttggcctgaacaccagtacagcagcaacgggaggaggcctt
tttaactcgggattgaacaagccagcaacgtccggattcggaggttttggagccaccagc
gcagcaccacttaatttcaacgcaggcaacacgggcggatcacttttcggaaatacagcc
aagccgggaggaggtctttttggaggaggtactacaaccttgggtggcacgggtgctgcc
ccaacgggaggactgtttggaggaggaactaccagtttcggaggtgtcggtggttccttg
ggcggaggaggcttcggtatgggtacaaacaactcgttaactggtggtattatgggagct
cagcccacactgggtatcatgacgccttcacaccagcccattcatcagcagatcctagct
agggtaacttctccctacggagactctccgattttcaaggatctaaagctaagcagtgaa
gcagatgcaacaagagctacaaatcctgctgcccaacaagcagttctggacctgaccagc
aaccagtacaagataagtaccagcaacaatcctgctccaatgaaggtaaaggcgctgggc
agcacacttaatagaaaatcgctgtttgatggtctcgaggagtttgatgcttctgtagag
ggcttcaatctgaagcccagtgctaaacgattagttatcaaacccaaagtaaaaagtgta
gagggtggaaatccctctagctctattggcagtgctcccaacacgccccaatctcgaccc
aaaggcgcaactcccaacaaagaacgcgagtcgtttagcggagccattccaagtgagccg
ctaccaccagctggaaactcgcctggagcaacgaatggacgggaaagtcaggataacggc
cgccgtgagtcatggctgcatcctaacaaccttgagaaggtacgccagcacaacattcag
actggaatggatcagggatcgccccataacagcaccctcaacgagcttgtgccacgtaaa
cctttagatacataccgaccatcctccaccgttcgcctctcggtgtcaaccatcccagag
aatccatttgaggatcaatccagcaccattgcacgtcgcgaaaccttcacttcgcagcag
gccaatgagagtgtgctttcgaacagatctaatgaggcagaggactctgcagcaaaccaa
tcccgcctagccattgaggcagctgctgcagaggcagcagacgacgaatcacatccaaca
ggcattgtgctgcgacgcgtgggttactatacaattccatcgctagacgacctacgctcc
tatctggccgaggacggatcctgtgtggttccgaactttacggtgggtcgggaaggatac
ggcaatgtcttcttcggcaaggaaatggatgtggctggcctgaacctcgatgagattgtc
cactttcgcaacaaggagattatcatttatcccgacgacgaaaacaagccgcccattggt
caaggtctaaaccgtgacgcccaggtcactttggaccaagtatggccgttggacaagacc
aagcacgaagccatcaaggacccacaacgcttgcttgagatggactgggagggcaagttg
cgccgggtgtgcgataaaaacgatacgcgctttatagaataccgcccggaaacgggtagt
tgggtcttccgcgtcaagcacttttctaaatatggcctgggagacagcgacgaagaggac
gagttgcccactgacccgaaaaaagccaaaattgcaacgcttgaggctcagcagcgggca
aacgcagaaaagatgacgctcaattcgctgcgccaagcgcagaagatttcagaagatgca
gcccgtaacttggacccaaaagccttggtcgcaggtgttgccagcggattcaggccaatg
gatgataccgccgagttccttttaatggacaaaacacaatttttccaagctggtggcaac
tccgatttctccatgtttgatccaccgcgtcaacgtccaacgattaccagtcccacagct
gttttggctcaggaaatggtaggcaacgaggcgcacaaaatgcagctaatgaagtcatcc
ttctttgtggaggacaatgctcccgaggacgaacccatggagactacggggcgtcttctt
cgtcatcgcaagtttttcaacgtggaacctcttgtttggaaagatggtgcctccgagagt
tccagtcagtacgattttgaacacccatcgcccgctctgccgatttcttcctccgtctct
gaggccagcctgatgtgtgatgcacattatgaggagacatcgtcgatggcaactggaagc
attgttgcagctgtaaaagaaacgaagtttgaaatgcctgtcactaaagccttcaagttt
gtctgtaagcccaaagtggctccgattaagttgcgtgccaccacggttcccctacccagg
tccatcgcttatgagatgcgcgataattggatcgccgatttgggattctacaaaggacgc
agctttaagctcagttttggtccacaaaactcattggtactgccaagcacctataataac
atgcaaaacctaaaagaatttactggaccatccctgcccgtctccatggtatttgcgccg
cgctcggccaccgatttgtcgcccagtgtaatgcagttggtggagtttaacatggtcaaa
ggcaacgagggttttcgagaaagtatcattccccatctcgaagttcagcttaacgactgc
ctctcagttaatgtggagggtagtgagtgcccgtgtatacatcccgatagcggtacgaaa
ctagtttccaagcacttctccgagtctcttaagcagagaaatgctggcttaaaagaggac
tatagcgtgtcagtgtggtcgcttttattcgcactatggggcgatcacgatgaactggtg
gacctggaaaagaactctcattacatggtcatgtgtcggcgcaatctgctatccgagtgg
cttgagaacacgctgctgggcaaagatctactctcgaaaaaagttagcacccacagctac
ctggagcacatgttggatttacttagctgccatcgcgtaaatgaggcttgtgagctggcc
ttcagctacgatgatgctaatctggctcttgtgctgtcccaattaagttccggagctgtc
ttccggctattaatggaggagcagctctttgcctggcagcagagcaagtcggataagtat
atcgatctggagcgccttaagatgtacatgctggccgccggagcgccaatgatgcagtct
tcacatggggccatcaacttactcgagaataaaaactggctgacagcactggccctgcag
ctatggtatttcacagccccaacatcgtctatcaccgatgcactcaatgcttataacgac
gccttccaagcggaagagtgctatgcggagcccccaaagcccagctacagggacgcacct
actgacaccaagaagcccgtctacgatttgcgctaccacttgctccagttacactctaaa
cgtatgcattccctggaagaaactctcaatcctataacgcataccgccgatgccatggac
tttcgtttgagctggctgctcttgcaaactctgcgagctcttggctaccgtcactgttcg
cccttaacggaggctcgtctttcggtggatttcgctagccagttggagaacgaaggcctc
tggcagtggggtatctttgttcttttgcatattaagcagcagacccagagggaacgtgca
gttcagcaaatgctacagaggaatgtcagcgtttccgccaaggtggctctatatgcggaa
gagcgctttatcgtcgaagagcttggtattccgatgtcgtgggtggactatgcgaaggcg
gtaaaggcgggagcgtcaggaaagcatcaccttcaagccaaatatctgctaaaggcaaaa
cattttgctacggcgcacgatgtcatcttccaacacattgctcctgatgccatcataaac
ggtaaaatgaaatacctgcatagcctgctcattcaattcgaggatacagagggcagcagc
atccgagtgcccaactgggccaaccagggccagatcttcctggactttatcgacatcagt
gccaagttcaaacagatccgcagtgtgaccaacatcgctgacatcaatgcgcgctgggag
aacttaaaaccacaactaagcgaactctgctcccgcatcagtctgctcccgtgccctacc
tccaagcaccgcctgtgccagagtgaaatctcgcagagcctcagctgcttggtgcacggc
atgtgcattgtctgtcccgagatggagtcttccacggtgcttaaggtggccctggagcgg
ctgccactgccgcaggagttcgcctcaaaggagctgcgcatctggctggaggagctacta
gacaaaatccaaaacgagccaccatttagcgagcggcagcaacccaccatgatggagata
tag

DBGET integrated database retrieval system