KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10244
Entry
Dmel_CG10244      CDS       T00030                                 

Symbol
Cad96Ca
Name
(RefSeq) cadherin 96Ca
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG10244 (Cad96Ca)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dme04090]
    Dmel_CG10244 (Cad96Ca)
   00536 Glycosaminoglycan binding proteins [BR:dme00536]
    Dmel_CG10244 (Cad96Ca)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     Dmel_CG10244 (Cad96Ca)
Protein kinases [BR:dme01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   Dmel_CG10244 (Cad96Ca)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG10244 (Cad96Ca)
Glycosaminoglycan binding proteins [BR:dme00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   Dmel_CG10244 (Cad96Ca)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Cadherin APH
Other DBs
NCBI-GeneID: 43026
NCBI-ProteinID: NP_651349
FlyBase: FBgn0022800
UniProt: Q9VBW3
Position
3R
AA seq 773 aa
MVYHHHNHESRIIHCRKQLTSWRRRSLLLTIIVVTATVVSLISQEAEAHNQNAPPILYVR
ERNWRISETEKVGQIIDRVRAEDPDGDDLIFGIEPRFSLPGGENDASPPEKIPFQIDRET
GVVTLNESLAGRAGQNFLIYITVTDGSYTAKNEVFINILGERENSSGYRPQTSISNVVHN
ISQFLPRFDQLPGVQSIRNGLPNSRPGGWYPPVPQNNIFGPPPFGNNYPPPPPNIPGVRG
EQSGEEEQPDEEVTPTTPVRISSTTPKSRTKLTPITANNSTRVESAIPAETTTPSGGHHN
NSSSPITIFSLKSGTIPIVVTVGGFFVAIAVLLAYLCRRRLCAISRTLKKTKEKEELAKK
SNQSQLSSTLTDDSRNSMVMQQWQGPVAFANRYVPWERDQQMGIATSQLSTGVTNGGVSS
PGVPSPGTGEPGSNLGPGCLTGGAGSSGAPENAFAGEANCDRWEFPRYRLKFFNILGEGA
FGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVMKSLEPHINVVHLLGC
CTDKDPTFVILEYVNRGKLQTYLRSSRAERHYGNTHGKSNVLTSCDLTSFMYQVAKGMDY
LTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLPIRWMATESLY
DNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVRDGYRLEKPEHCRRELYNIM
YYCWSHDPQERPLFAEIIQMLDKLLHTEMDYIELERFPDHNYYNIVSLSGEKL
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggtttatcaccatcacaaccacgaaagtcggataatacactgcagaaaacaattaact
tcctggcggagaagaagcctgctgctgaccatcattgtggtcacagccacagtggtttca
ctgatttcacaagaagccgaggcccacaatcagaatgcaccaccgattctatatgttcgc
gaacgcaactggcgtatttcggagaccgagaaagttggccagataatcgatagagtgcgg
gcggaggatccggatggcgatgatctgatatttggcatagaaccgcgattcagtctgcct
ggtggtgaaaacgatgctagtcctccggagaagataccctttcaaattgatcgagaaacg
ggagtggtaactctcaatgaaagtttggcaggaagggctggtcagaattttctcatctat
ataactgtcaccgatggctcctatacggcaaagaatgaggttttcatcaatatcttgggc
gagcgggagaatagctccggctatcgaccgcagacatcaatttcgaacgtggtgcacaat
atatcgcaattccttccacgttttgaccagctgcccggtgttcaatccatccggaatggg
ctgccaaacagccgaccaggcggttggtatccaccggtgccccagaacaatatattcggt
ccgccgccattcggtaacaactacccaccgcctccgccgaatattcccggcgtgcgggga
gagcagagtggagaagaggagcagccggatgaggaggtgacacccacaacacccgtcaga
atcagctccaccacgccgaagagtcgcaccaaactgacgccgataactgccaataattca
acgagagtcgaatccgcaatccccgcggagacaacgacaccgagtggcggccaccataat
aatagctccagtcccatcacaattttctccctcaagtccggcacaattccgattgtggtc
accgtgggcggattctttgtcgccatcgccgtgcttctggcgtacttgtgccgccgacgc
ctctgcgccatcagcaggacgctaaagaagaccaaggagaaggaggagctggccaagaag
tccaaccaaagccagctgagcagcacgctgaccgacgacagccgcaactcgatggtcatg
cagcagtggcaaggacctgtggccttcgccaatcgctatgttccctgggagcgggatcag
cagatgggcattgcaacgtcccagttatcaacaggtgtcaccaatggcggagtgtcctcc
cccggagtgcccagtcccgggacaggtgagccgggttccaacttgggcccgggctgcttg
acaggtggagcaggaagttccggcgcaccggaaaacgcttttgccggcgaggccaactgc
gaccgctgggaattccccaggtaccgattgaagttcttcaatatcttgggcgaaggagcc
ttcggacaagtttggcgctgcgaggccactaatataaatggcaacgagggcattacaacc
gtggctgtgaagacgctcaaggaaagtgccaccgaagtggatcgcaaggacctcttatcc
gaactggaggtaatgaaatctctggagccacacatcaatgttgttcatttgttgggctgc
tgcacggacaaggatcccacatttgtgattctggagtacgtgaatcggggaaaactgcaa
acgtacctacgcagctcacgcgccgaaaggcactatggaaacactcatggaaagtcaaat
gtactaacgtcctgcgacctaacatcctttatgtatcaagtagctaagggcatggactac
ctaacatctcgaggaattatccatcgtgacttggctgctcgaaatattctcataaccgat
gatcacacttgcaaagttgcggactttggcttcgcacgagatgtaatcacctcgaagatt
tatgaaagaaaaagcgagggcaagctgcccatcagatggatggctacagagtcgctatac
gacaatatattctccgtaaagtcggatatctggagcttcggcatactgatgtgggaaatt
gtgacgctgggatcgacgccctaccctggcatatcagcagcagatgtgatgcgaaaggtg
agggatggatatcgtctggagaagcccgagcactgtcgtcgggagctgtacaacataatg
tactactgctggtcccacgatccccaggagcgtcctctattcgcggaaataatccaaatg
ctcgacaagctgctgcacacggaaatggattatatcgaactcgagcggtttcccgatcac
aactactacaatatcgttagtcttagtggtgaaaagttgtag

DBGET integrated database retrieval system