KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1031
Entry
Dmel_CG1031       CDS       T00030                                 
Symbol
alpha-Est1
Name
(RefSeq) alpha-Esterase-1
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9
Other DBs
NCBI-GeneID: 40909
NCBI-ProteinID: NP_524269
FlyBase: FBgn0015568
UniProt: Q9VIC3
Position
3R
AA seq 565 aa
MEIRVGVGDLLKMGTKLIGHKIVQYRLGTKQTKVVCTRDGQVRGHRRRTLYDEEMYFAFE
GIPFAQPPVGELRFRAPQPPHPWLGVRDCTYPRAKPMQKHFVLSIVEGSEDCLYLNVYSK
RLRSDKPLPVIVWIYGGGFQFGEAGRDFYSPDYFMQQDVVVVTFNYRVGALGFLSLADRD
LDVPGNAGLKDQVMALRWISQNIAQFNGDPQNITVMGESAGAASVHALMTTEQTRGLFHK
AIMQSGSMFCEWANEPSGRWAYRLACQLGYSGSENEKEVFRYLQKAPASEMAAQGITLVS
QEERRQYVLFPFTPVVEPYITRDCVLPRCHREMLPEAWGNDLPLILGGNSFEGLFSYQST
LHDEEHMLSAFEVLIPREIREKSTQSHLKDLLRQFKVDNFDDATRGRMEFNECLHILSVK
HFWHGIHRTVLARLSHAPATPTYLYRFDVDSPHFNHFRQVMCGKHVRGVSHADDLSYLFY
HILANKVDKSSMEYQTIQRLVGMWVAFARNDNPNCPQIGPTTWEALDEKGPQMCLNIGKQ
LEFIVLPESKQNRIWDRLYDKNDLF
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggagatccgagtgggagtgggcgatctgctgaaaatgggcaccaagctcattggccac
aagatcgtccagtatcgccttggcacaaagcagacgaaggtggtctgcaccagggatggc
caggtgcgcggacatcgccgaaggacactctacgacgaggagatgtacttcgccttcgag
ggaatcccctttgcacagccgccggtgggggagctgcgcttccgagccccccagccacca
catccctggttgggggtgcgggattgcacctatccgcgggccaagccgatgcaaaagcac
ttcgtgctcagcatcgtcgaaggcagcgaggattgcctgtacctgaacgtatattccaag
cgcctgagatcggacaagccgctgcccgtgatcgtgtggatctatggcggtggattccag
ttcggcgaggctggtcgagatttctacagtccagactactttatgcagcaagacgtagtg
gttgtcacattcaattatagggtgggcgcattgggcttcctcagcctcgcggatcgcgac
ttggatgtgcccggaaatgctggtctcaaggaccaagtgatggcccttcgctggatcagt
cagaacatagcccaattcaatggagatccccaaaatataaccgtgatgggcgagagtgcg
ggagcagcctccgttcacgcgttgatgaccaccgagcaaacccgagggctgttccacaag
gccatcatgcaatcgggatccatgttctgcgagtgggccaatgagccaagtggcaggtgg
gcataccgactggcctgccaattgggatactcgggcagtgagaacgagaaggaagtgttt
cgataccttcagaaagcacccgcctccgaaatggccgcacagggtattactcttgtctcc
caagaggaacggcggcagtacgtcctgtttccctttactcccgttgtggaaccatatatc
accagggattgcgttttgccccgttgccacagggagatgctgccggaagcttggggtaat
gacctgccgctgatcctgggcggcaactcctttgaaggtctgttctcctaccagagtacc
ctgcacgacgaggaacacatgctgagtgcttttgaggtcctaattcctcgggagatcagg
gagaagagtacccagtcgcatcttaaggatctgctacgtcaatttaaggtggataacttc
gatgatgcgactcgagggcgaatggagttcaatgagtgcctgcacatactgtccgttaaa
cacttttggcatggcattcatcgcactgtattggcccggctcagccacgcccccgcaacg
cccacctacctgtaccgcttcgatgtggactcgccccatttcaatcacttccggcaggtg
atgtgcggaaaacacgttcgcggagttagtcatgccgacgatctctcctaccttttctat
cacattttggccaacaaggtggataagtcctcgatggagtaccaaaccatacagagactg
gtgggcatgtgggtggcattcgcccgaaacgacaatcccaattgtccacagatcggcccg
accacatgggaggcactagatgagaaaggtccgcagatgtgtctcaatattggaaaacaa
ctggagttcattgtgctgccggagtcgaaacagaatcggatttgggatagactatacgat
aaaaacgacttgttttag

DBGET integrated database retrieval system