KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10426Help
Entry
Dmel_CG10426      CDS       T00030                                 

Gene name
INPP5E
Definition
(RefSeq) inositol polyphosphate 5-phosphatase E, isoform B
  KO
K20278  inositol polyphosphate 5-phosphatase INPP5E [EC:3.1.3.36]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00562  Inositol phosphate metabolism
dme01100  Metabolic pathways
dme04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmel_CG10426 (INPP5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Dmel_CG10426 (INPP5E)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     Dmel_CG10426 (INPP5E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 39404
NCBI-ProteinID: NP_001261753
FlyBase: FBgn0036273
UniProt: Q9VTW2
Position
3L
AA seq 747 aa AA seqDB search
MQHSSAGSEERITSSTSSPRSGHKTASSLFGLLSKRPSKVEPHPVTPESPRLQQRPVSAC
GQYDVSFAKCNADTSANHVNNNGSTLKSQTLPLEKSHSGLISFHRRAKPSSSKGKNHSHR
HSTDAGSQSDGGADVVMRRKSPKHRSPNHNRFSHQFSLCCKAEKKPMTPPVTVRYNSIPD
SNSVLRRDNLSLSWSMVDNNSGSLHSSEGSSHRPRPSSECASAPESPVASKTFFAHCSPA
AASASVARSESLQNRSPIRPMAVSACRSRLRLKLYPPGQELPPLQAATEPGDIKRATTPQ
HMSSPNIATQPDGIEHIEEQPGVRFMSHENMTLQRQGSGSNLARQTLMAAHALNLIPADN
ARERSYLDGRLGSTSLLGPSELSRVLPQKEITVFVGTWNMNGHSPPKQLNDFVLPANVEH
VPDIVVMGTQESTPDRFEWEVTIQETLGPSHVLFHATTLGTLHLAVYMRRDLIWYCSVPE
DASMSVRTGSAFRTKGAVAISFCLFGTSMLFVTSHLTAHQQKVKERVSDVKRIINALDLP
RNLPNQRHKNKDVTQNFDNVFWCGDLNFRLGEPREKLLEWIQNTKFPLPSHLPHGYMHTD
QLTSVLADGAAFRGFMEANITFPPTYKYDPGSQNFDTSSKQRAPAYTDRILYKYRQMQGL
VIRRQTLVPGVSTPTQPHVQCLLYDSVPSITTSDHKPVWALFRTLIRAGTDAIPLAAGLF
SRDIYLEGMRRRLNNQYSGASAVCVLQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacagcagcgcgggaagtgaggaacggataaccagttccaccagcagtcccaga
tccggtcacaagaccgcgagctccctgttcggtttgctgagcaagcgacctagtaaggtg
gagccacatcccgtgacacccgaatcgccaagattacaacagagacccgtgtccgcctgt
ggccaatacgatgtcagtttcgccaagtgcaatgcagatacgtctgcaaaccatgtcaat
aacaatgggagcaccctcaaaagccaaacgctgccgctggagaagtcgcacagcgggctg
atcagcttccacaggcgtgcaaagccaagttcctcgaaaggaaagaatcactcgcaccgg
cacagtacggatgctggttcccaaagcgatggaggagccgacgtggtgatgcggcgcaag
tcgcccaagcatcgctcacccaatcacaatagatttagtcaccagttcagtctgtgctgc
aaggcggaaaagaaaccgatgacaccgccggtgaccgtgcgttataactccataccggat
agcaacagtgttctgcggcgcgataacctctcgctaagttggagcatggtggacaacaac
tcgggctcgctgcactccagcgaaggatcctcacaccgaccgcgtccgtccagtgagtgt
gccagtgcgccagaatcaccggtggccagcaaaaccttctttgcccactgcagccctgct
gcggccagcgcttcggtggcacggagcgaaagccttcaaaatcgctcgcccattcgaccc
atggcagtatcagcctgccgatcccgactgcgtttaaagctctatccacctggacaagag
ttaccccctcttcaggcagccacagaacctggtgacattaaaagagccaccacaccacag
cacatgtcctcgccgaatatagccactcagccagatggaatagaacacatagaggagcag
ccaggcgtgaggtttatgtcgcacgagaacatgacactccaaagacagggttcgggatct
aatctggctcgccagactttaatggcggcacatgcattgaatctgatcccggcggataac
gccagggagcgaagttacctggatggcaggctgggatcaacttcccttttgggtcccagt
gagctaagccgcgtgctgccgcaaaaggagattaccgtctttgtgggaacttggaatatg
aatggccacagtccacccaaacaacttaatgattttgtgctgccagccaatgtggagcac
gtgcccgacattgtggtaatgggcacacaggagtccaccccagaccgcttcgagtgggag
gtcaccattcaggagaccctaggtccctctcacgtgctcttccatgccacaactctgggt
accctccacctggctgtgtatatgcgacgggacttgatctggtactgctccgttcccgag
gacgcatctatgtcggtgcgcacgggctccgcctttcggacaaagggtgccgtggccata
tccttttgcctgtttggcacttccatgctgtttgtgacctcgcatttaacggcgcaccag
cagaaggttaaagagcgtgtgtcggacgttaagcggataatcaatgctctggacttgcct
cgcaatttgcccaatcagcggcataagaacaaagatgtcacgcagaactttgacaatgtc
ttctggtgcggcgatcttaactttcgactgggtgagccgcgtgaaaagctgctggaatgg
attcagaacaccaagttcccgctgccgtcgcatttaccgcacggttacatgcacacggat
cagttgacttccgttctggctgatggcgccgccttccgaggatttatggaggcgaacatc
acatttccacccacgtacaagtacgatccgggcagccagaactttgatacctcgtcgaag
cagcgagctcccgcctacacggatcgcattctctacaagtaccgccaaatgcagggacta
gtcatccgtcggcagaccctagtgcctggtgtatccacacccacgcagccgcatgtccaa
tgtctgctctatgactcggtgccatcgataaccacctcggaccacaagccagtttgggcg
ctttttcgaacactcatacgtgcaggaaccgatgcaattcccttggctgctgggctcttc
agtcgcgacatttatctggagggaatgcgtcgacgcttgaataaccaatatagcggcgcc
tccgccgtttgtgtgttgcagtaa

DBGET integrated database retrieval system