KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10497Help
Entry
Dmel_CG10497      CDS       T00030                                 

Gene name
Sdc
Definition
(RefSeq) syndecan, isoform A
  KO
K16336  syndecan 2
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dme04090]
    Dmel_CG10497 (Sdc)
   00535 Proteoglycans [BR:dme00535]
    Dmel_CG10497 (Sdc)
CD molecules [BR:dme04090]
 Proteins
  Dmel_CG10497 (Sdc)
Proteoglycans [BR:dme00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   Dmel_CG10497 (Sdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan Glycophorin_A SOG2
Motif
Other DBs
NCBI-GeneID: 37447
NCBI-ProteinID: NP_476965
FlyBase: FBgn0010415
UniProt: P49415
Position
2R
AA seq 399 aa AA seqDB search
MKPKQKISVEPLLLVAILIGVLVAATHAQDQKSVKPSAAAPSAAASRPHDEIYIDDDSIE
GSGGRGGIHEDLEKDPDYSGSGFGPDDEDAEPDQHSHSSHNTRISQSSNSGINTAHTPTQ
TSSTIPTTSTSTPMPTTTPTATTPASTTTAAATQISSFANSSSTTTTTLAPTIPAEPQQP
LFPPFDKDLDTESSGDGIDADAEDDDEDDGDDKDYDYNKELDKEIDIDGPEPGHLPPVVH
HNTVETGHIPTTDEIDVDGGDEDDNGDSDIDGPRIGGNDGDITERGPGAGGSNVHELDPN
TNVNSQPSDTKGIDHRPNGNEVVIMSEDDRTSSFFSQPGILAAVIGGAVVGLLCAILVVM
FIVYRMRKKDEGSYALDEPKRSPANNSYAKNANNREFYA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaaagcagaagatttccgtagagccgctattgctagtcgcaattctcatcgga
gttctggtagccgccacccacgctcaagatcagaaatcggtgaaaccatcggcggcagcg
ccatcagcagcagcttctcggccccatgatgaaatctatatcgacgatgatagcatcgag
ggatccggcggacgcggcggtatacacgaagatctagagaaagatccggactattctggc
tccggctttggacccgatgacgaggacgccgaacccgatcagcattcgcacagttcgcac
aacacgcgcatctcgcagagcagcaactccggcataaacacagctcatacaccaacacaa
acctcatccacaatcccaacaacatcgacttcgacaccaatgccgacaacaacccccaca
gcgacaacccccgcatccaccacaacggcggcagcaacccagatatcgtcctttgccaat
agcagtagcaccaccaccaccacgttggctcccacgattcccgcagaaccgcagcaaccg
ctgttcccgccattcgacaaggatctggatacggagtccagcggcgatggcatcgatgct
gatgctgaggatgacgatgaggacgatggcgacgataaggactatgactataacaaggag
ctggacaaagaaatcgacatcgatggtcccgagccgggacatctgccgccagttgtccat
cataataccgttgaaactggtcacatacccactacggatgaaatcgatgtggatggcggc
gatgaggatgacaatggggatagcgacatcgatggtccgcggatcggtggcaacgatgga
gatattacagagcgcggaccgggtgcaggtggcagcaacgtgcacgaattggaccccaat
acgaacgtgaatagccagccctccgacacaaagggcatcgatcacaggcccaacggcaac
gaagtggtcatcatgagcgaggacgatcgcacgtcgagcttcttctcgcagcccggaatt
ctggctgctgtcattggcggtgccgtcgttggcctgctctgcgccatactcgtggtcatg
ttcatcgtgtaccgcatgaggaaaaaggacgagggatcctatgcgctggacgagccaaag
agatcgccggccaacaattcgtatgcgaaaaatgcgaataaccgcgagttctacgcctga

DBGET integrated database retrieval system