KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10538
Entry
Dmel_CG10538      CDS       T00030                                 

Gene name
CdGAPr
Definition
(RefSeq) Cd GTPase activating protein-related, isoform D
  KO
K20647  Rho GTPase-activating protein 32
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG10538 (CdGAPr)
Membrane trafficking [BR:dme04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    Dmel_CG10538 (CdGAPr)
SSDB
Motif
Pfam: RhoGAP SH3_9 SH3_1 SH3_2
Other DBs
NCBI-GeneID: 35267
NCBI-ProteinID: NP_001260600
FlyBase: FBgn0032821
UniProt: Q9VIS1 M9PDR8
Position
2L
AA seq 1843 aa
MSDKVSTSLAAQLHSHALASAEAGGIGGVNGGPIACHASTDKDAQAPPLQFEMDAPAAAI
SAQLNFKIVPADSLPGLSYQDMFASMNTSQISNASTESSCSPPIQGAVPPPKPSRHMAVQ
PLNSKSCRFPKLEECAHFHYERVQLGPLSVQLLDDKSEHMGSSIASQSLGGDLPHSSLRS
FSPESCWFIIRVCPQRCEPFLIKRSFENMQLLDEMLHRCVYDRKISGLRNMEELAAELPS
ESDVEYAVAKYLERFSKIASDSLTCGTILTWLQLDNKGRRLPLADGETQRTINTPAVGAA
YGVRRYQAQAPDEINIEVGDMISVIDMPSPAESIWWRGKKSHLQKSLYEVGFFPQSCVAT
IGDKVPRNFPMPAPLVGHLDASPTKPVLRKHGKLIAFFRSFILSRPSRRRLKQSGIYRER
VFNCDLSEHLLNSGQDIPMVLRSCAEFIENYGVIDGIYRLSGITSNIQRLRRAFDEERVP
DLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETV
LKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGV
GVQAVVTEYLIRNCHNIFDALDDHPARHSMVASATAAAANAAGGELRLESLTDCESLLVE
QREQDQSLGVVERPKSLSTGGAKLISLEEAQERHSRVEGADLKQSLPISMLTSASSNAAS
NIGSYIEVGGGPSSLPDKYHTVLSAPRSWQKRKPDKTPSWKSIFSRSQRQGNPDPGQKIT
TDVKDSVASRVSFVQASHAHASKELTKHDKPKSIELLETTSNERDPKPMDLCIRSNSIDS
LRTVGHSRSVSHDSYFDLLQSPQRGHMTTCPSRELSELGLNFDREEPEMRIFSESESLVS
SPRVGKENVPPASGSATRRIMRARPEDFSSQTNSVNPSPKKQPRLNLLSPSSARTMPPPP
LSAPGTASSSCGHESGGAENCCKRYKLEDQLCDIQFIDCGTPENVPTTQQQFASVEVHPP
PKPARANQSPISSSNGASVGSSSSSTRYSYPSVQLGAKRKEQQDAKERFSYQGTFTQPGQ
KQESSAPRPVHSTNNGATLRKPRVEPVEDGQIKLHVPTPTTPARSPRYSLLLCDTESSDN
SSAVNTPQYDMEPLMLTSAMSGVSGVSSNVQQQQLLLGVDASSSYLGSSHESLGQNINNH
HDAEQRDMNALKRELSLDLNPLQPRLPQPANRAATLPVKDQLQAAAAAMCSSPNNSNFTD
NTSQSVTPSEYGYQHLQRQLSMHSLLATDESSPVYEDFEQTPVKMVPSPIKSTISITYKS
PEKEKKPSAILETNFDENTVYEQVKLFRNSVTEVNQMLHERSSLKQIAEEEQHDGGAYKA
AEMTQQLLQLEQEHHDHEEQQEKEPEDEEQSQLLYENIELRKPKTVYENLRGEEMKFITE
EQKPNVDRIELDSLDSLPDNMEHEQSSPSKSPTFSVKELANKFESSPVEQLPNFDFSVRG
GSMKKPNELSVPKTMPAPVPLKKLNSSAQKITRSLDENAFVREFGGKQLQDLSLSNKLPE
VMSEVNSRRKSFDFTRPKTLNPPKRLPGMSITEEICQKRVGEMEAITPTTENRISLIQQN
NMPKEQQSSANQFLPPAGRKNVLTGVVLDRERIDKIKEERRQQLTQKYYGDTLKSRSRTE
LNSEDNFPAAESLRIKSKSRGDMHALQKDIDMNLKQLSRVTGGGSECTLHTGLSQGNGQE
HLGQQRVRRISDEKNQNCDTSNGGVSGITSTSLLSVKTTAQKYGSTSKTPANKFERSQPM
PRDRLQRNSLAESNAGTNNREKISPQFSIRDVTAMFESRSQNQ
NT seq 5532 nt   +upstreamnt  +downstreamnt
atgtcggacaaggtgagcacatccttggcagcccagctgcattcccatgccctggcgtcg
gcggaagcaggtggtattggtggagtgaacggtggcccaattgcctgccatgccagcacg
gataaggatgcccaggctccaccgctccagtttgaaatggatgctccggcggccgccatc
agtgcccagctaaacttcaaaatcgtgcccgctgacagtttgccaggcctgagttatcag
gacatgttcgcctccatgaatacatcacaaatctccaatgcctccacggagtccagctgc
agtccgcccatccagggcgctgtaccgcctccaaagcccagtcgtcacatggccgtacag
ccgctgaatagcaaatcgtgccgatttcccaagctagaggagtgcgcccacttccactac
gaaagggtccagctgggtccgttatccgtgcagctgttagatgacaagtcggagcacatg
ggcagcagtattgcttcccaatctcttggcggtgatttaccacacagttcgctgcgcagc
ttttctccggagagctgttggtttatcatccgcgtgtgcccacagcgctgcgaaccgttc
ctgatcaagcggagcttcgagaacatgcaactgctggacgagatgctccaccggtgcgta
tacgaccggaaaattagtggactgcgcaacatggaggaactggcggccgagctgcccagc
gaatcggatgtggaatatgcggtggccaagtacctggagcgtttctcgaagatcgcctcc
gattcactgacctgcggcacaattctgacctggctacagctggacaataagggcaggcga
ctaccgctggcggatggtgagacacagaggactatcaacacacctgcggtgggtgccgcc
tacggagtgaggcgttatcaggcccaagctccggacgagatcaacattgaggtgggcgac
atgatttccgtgatcgacatgcccagtccggcggagtcgatttggtggcgcggcaagaag
tcgcatctgcagaagtccctctacgaagtgggttttttccctcaatcctgtgtggccact
atcggcgataaggtgcccaggaattttccaatgccagcaccgctagttggtcacttggat
gcttcacccactaagccggtgctgcgtaagcacggcaaactgatcgccttcttccgttcc
tttatcctgtcgcgaccatcacgtcggcgcctaaaacaaagtggaatttaccgcgaacgc
gtctttaactgtgacctgtccgagcatctgctgaacagcggtcaggacatacccatggtt
ctccgatcctgtgcggagttcatcgaaaactatggcgttatagatggaatttaccgtctt
tccggcatcacctccaacatccagcggctaaggcgcgccttcgatgaggagcgtgtaccg
gatttgggtaaccctgaaatgaagcaggatatccatgcagtaagttcgctgctcaagatg
tacttccgcgagcttccaaatcccctgtgcacctaccaactgtacgacaactttgtagag
gccatccaagtgaaggccgacgaggcggacgagcggctgcgacttatgaaggagacggtg
ctcaagctgcctccgccacactatcggaccctaaaatatctggccgagcacttgtacaag
gtgtcacaacaccacggtcgcaccggaatgacggacaagaatctggccattgtttgggcg
ccaaatttactgcgctcacctgccctggaatcggggggcgtggctgctctgcgtggcgtt
ggcgtgcaggcggtggtcaccgagtacctgatacggaattgccataacatcttcgacgct
ctggacgatcatccggcgcgacacagcatggtggcgagtgctacggctgctgctgcgaat
gcggctggtggtgagctacgcctggagtcacttaccgactgcgaaagtctgctagtggag
cagcgggagcaagatcaatctttgggcgtggtggaacggccaaagagtctgagcaccggt
ggagccaaactgataagcctggaggaggcccaggaaaggcattcgcgagtggagggggct
gacctcaagcagtcgctgcccattagcatgttgaccagcgctagtagcaacgctgcctcc
aacattggctcctacatcgaagtgggcggtggtccatccagcttgccggataaataccac
acggtgctgtcggccccgcgcagctggcagaaacgtaagccggacaagacgccgtcttgg
aagtcgattttctcccgcagtcagcgacagggtaatcccgatcctggccagaaaataacc
acagatgtcaaggattccgttgcttcccgcgtgagctttgtgcaggcatcacatgctcat
gctagcaaggaactgaccaagcatgacaagcctaaatctattgaactcctggagacaacg
agcaatgaacgtgatccgaaaccaatggacctgtgcatacgctccaattcaattgatagc
ctgcgcactgttggtcattcgaggagcgtctcgcatgactcgtacttcgatttactgcag
tcaccgcaaaggggtcacatgacgacatgtccgtcgcgggagctttccgagctaggtctc
aatttcgaccgcgaagagccggaaatgcgcatcttctcagagagcgaatctctggttagc
tcaccgcgcgtgggcaaggagaatgttccacctgcctctggctccgccactcgtcgcata
atgcgcgctcgtcctgaggatttctccagccagacaaatagcgttaatcccagtcctaaa
aagcagccacgcctcaatctcctatcgcccagctcggccaggacgatgcccccaccgcct
ctttcagcgcctggaactgcatcttcctcctgtggacatgaatccggtggagctgaaaac
tgctgtaagcgatacaagctggaagatcagttgtgtgacattcagttcattgactgtgga
actcccgaaaatgtgcccaccactcaacagcagttcgccagtgttgaagtgcacccgcca
ccaaagccagctagggcaaaccaatctcccatatcgtcgtcgaatggtgcatctgtaggc
tcctcctcctcgtcgacccgctacagctatccgtctgtgcagctgggggccaaacggaaa
gaacagcaggatgctaaggagcgtttcagctaccagggaacctttacgcagccaggacag
aaacaggaatcttcagctccaagacctgtgcacagtaccaacaacggtgctactctacga
aaacctcgagtggaacccgtcgaagatggtcagatcaagctgcatgtgcctacgcctaca
acacctgcccgcagtccccggtactccttgttgttgtgcgacaccgaaagctccgataac
agttcggcggtaaatacaccgcaatatgacatggagccccttatgctgacatcggccatg
tctggcgtatccggtgtttcatccaatgtacagcagcagcagctgcttttaggtgtggat
gcgtccagcagttacctaggcagctcgcacgagagcttgggacagaacatcaacaaccac
catgatgctgagcagcgtgatatgaatgccctaaaaagggagctatccttggaccttaac
ccactgcagccgcgcttaccacagcccgcaaatcgagctgccactttaccggttaaagat
cagctgcaggctgctgcagcggccatgtgctcatcgcccaacaattccaattttacggac
aatactagtcagtcagtgacaccgagcgagtatggttatcagcacttgcagcgacagcta
agcatgcactctctgctggcgactgatgagagttcgcccgtgtacgaggacttcgaacag
acccccgtcaagatggtgcccagccccataaaatccaccattagcatcacatacaagtcg
cccgagaaggaaaagaaaccttcggccatcttagagaccaacttcgatgaaaacactgta
tatgagcaggtgaagctgttccggaactcggtaaccgaggttaatcaaatgttacatgag
cgttcaagcctgaaacagattgccgaggaggagcagcacgatggaggtgcttacaaggca
gcagagatgacgcagcaactgctgcagcttgaacaggagcaccacgaccacgaagagcag
caggagaaagagcctgaggatgaggagcaatcccagctactttacgaaaacattgagcta
cgcaaaccgaaaacagtttacgaaaatctacgtggcgaggagatgaaattcattacagaa
gaacagaaacccaacgttgatagaattgagcttgatagtttagacagcttgccagacaac
atggaacacgaacagtcgtcgcccagcaaatcgcccactttcagtgtcaaggagttggcc
aacaaattcgagagctcgcctgtggagcagctgcccaactttgatttttcggtgcgtggc
ggctcgatgaagaaacctaacgaactgagcgtacccaagacgatgcccgcacccgtgcca
ctcaagaaactgaacagcagtgcccaaaaaataacccgctcgttggatgagaacgccttc
gtcagagagtttgggggcaagcaactacaagatctgtctctctctaacaaactgcccgaa
gtaatgtcagaggtcaacagccggcgcaagagctttgacttcacgcgacctaaaaccttg
aatccaccaaagcggttgcctggtatgagcattaccgaggagatatgccagaagcgtgtt
ggcgaaatggaggcaattacccccaccaccgagaaccgcatctcactcatccagcagaat
aatatgcccaaagagcagcaatcgtcggctaatcagttcctgcccccggcgggtcgaaag
aacgtattaacaggcgtggtcttggatcgtgagcgcatcgacaaaatcaaggaggagcgg
cgtcagcagctaacgcaaaagtactacggcgatactctcaagtctcggtcgcgtacggaa
ctgaactctgaagacaacttcccggctgcagaatccctgcgaatcaagtccaagtcacgc
ggcgatatgcatgccttgcaaaaggatatcgacatgaacctaaagcaactgagccgcgtc
actggcggcggatcggagtgcaccctccacacgggcttgagccagggtaacggacaggag
catctgggacaacagcgcgtgcgccggatttccgacgaaaagaaccaaaattgtgatacc
agtaatggtggcgtaagtggcataacctccacttcgctactcagcgtcaagacgacggcc
cagaaatatggaagcaccagcaagacgccagcgaataaatttgaacgtagtcagcccatg
ccacgcgatcgcttgcagaggaactccttggccgagagcaatgcaggcaccaacaacaga
gaaaagatctcaccacaattctcaatacgcgacgtgacagcgatgttcgaatctcgttca
caaaatcaatag

DBGET integrated database retrieval system