KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1058
Entry
Dmel_CG1058       CDS       T00030                                 

Gene name
rpk
Definition
(RefSeq) ripped pocket, isoform B
  KO
K03440  acid-sensing ion channel, other
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG1058 (rpk)
Ion channels [BR:dme04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   Dmel_CG1058 (rpk)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 40580
NCBI-ProteinID: NP_001246909
FlyBase: FBgn0022981
UniProt: A0A0B4K691
Position
3R
AA seq 568 aa
MTISDSELDSSKGIDLTFRRRRKAGSVACEGFITTYHEYCRNTSIHGVQYLGEQERPFRE
RIFWLFVFLISIYGCSTLIQSAYTKWTETPVIVSFAEKSTPVWNIPFPAVTVCSETKRVL
KQKGKETTYADLYSQFSEDMRASRVFRPENVSALEMEEFRTLLHVCNTQIIEEDIPLIAG
DDLDYFDVLQRMLPQFDRYFFYCRWLSRFGECETFFRKTLTEEGICYTFNGLRATEIYRD
DTYQYQHSGEPLEMENISSQHTAWTLETGYALDSDVETFPARVLSAGARSGIFLALQSFK
QEVDYACRGPVQGFKVGKFENVLLHAPDDVPQVSKQFVRIPMGKEVLIAVKPNMITMSSG
IAEYHPVRRQCFLSHERSLRFFKVYTESNCQLECLANFTLTKCGCVKFSMPRNVDMPVCG
EDKIHCYDRAERELLVREFKRVKALNAGRENSRSVESACNCMPACTSLVYNTEISQANFD
LEEMLVAEGDTEFLKEYPGSQMSRLSIYFKQSQFITSKRSELYGMTEFLANCGGIFGLFM
GFSILSLVEMIYHFTLRLFTNLKRLVKG
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgaccatatcggattcggaactcgacagcagcaagggcatcgacctgacattcaggagg
agaaggaaggcaggttccgtcgcctgcgaaggatttatcaccacgtaccatgaatactgc
aggaacacttccatacatggtgtccaatatcttggcgagcaggagcgccccttccgcgag
cgcatcttttggctgttcgtgttcctgatctcgatctacggctgctccacgctgattcaa
agtgcctacaccaagtggaccgaaacgcctgtgatcgttagcttcgcggaaaaatcgacc
cccgtgtggaacatcccgtttccggcggtcacagtttgctcggagaccaaaagggtgcta
aagcagaaaggaaaagagaccacttatgctgatctttacagccagttcagcgaagatatg
cgagcttcgcgggtgtttaggcccgaaaacgttagtgcccttgagatggaggagttccgc
accctgctgcacgtatgcaacacgcagatcattgaagaggacatacccttgatagccggc
gatgacttggactactttgatgttctgcagcggatgctgccccagtttgatcggtacttc
ttttactgccgctggcttagtcgtttcggcgagtgcgagaccttcttccgaaagactctt
acggaggagggcatctgctatacgttcaatgggctgagagccactgagatataccgggac
gacacctatcagtatcaacacagcggggagcccctggaaatggaaaatattagctcgcag
catacggcctggactctggaaacgggctatgcactggacagcgatgtggagacctttccg
gctcgtgtcttaagtgccggagcgcgatctggcattttcttggccctccaaagctttaag
caggaggtggactacgcctgtcgaggacctgtgcagggatttaaggtgggaaaatttgaa
aacgtactgcttcatgcgcccgatgacgtcccgcaggtttccaaacagtttgtgcgcatt
cccatgggcaaggaggtgctgatcgcagtgaagcccaacatgatcaccatgtcgtcggga
atagcagagtaccatccagttcggaggcagtgcttcctcagccacgagcggtcgctgcgt
ttttttaaggtgtacaccgaatcaaattgccaactggagtgcttggccaacttcacgctg
accaagtgcggatgcgttaagttctcgatgcccagaaacgtggacatgcctgtatgcgga
gaggacaagatccactgctacgatcgggcagaaagggagttgttagtcagggaattcaaa
agagtaaaagcgctgaacgctggccgagaaaattcgcggagcgtggaatctgcctgtaac
tgcatgccagcatgcacatccctcgtctacaacacggagatttcccaggccaactttgat
ttggaagaaatgctagtggctgagggcgacactgagttcctgaaggagtatcccggctcc
cagatgtcccgcttgtccatttacttcaagcagagtcagttcatcacttcaaagcggtcg
gagctttacggaatgaccgagtttctggcgaattgcggtggcattttcggtctattcatg
gggttctccatcttgagtcttgtggaaatgatctaccacttcacgttgcggctctttacc
aatctgaagcgcctggttaaaggataa

DBGET integrated database retrieval system