KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10679Help
Entry
Dmel_CG10679      CDS       T00030                                 

Gene name
Nedd8
Definition
(RefSeq) Nedd8, isoform B
  KO
K12158  ubiquitin-like protein Nedd8
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG10679 (Nedd8)
Ubiquitin system [BR:dme04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   Dmel_CG10679 (Nedd8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD HATPase_c Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 35151
NCBI-ProteinID: NP_001286070
FlyBase: FBgn0032725
UniProt: Q9VJ33 X2J935
Position
2L
AA seq 84 aa AA seqDB search
MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYK
VQGGSVLHLVLALRGGDSILTPCV
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcaaagtgaagaccctgaccggcaaggaaatcgagatcgacattgagcccacg
gacaaggtagatcgcatcaaggagcgcgtggaggaaaaggaaggcattccgccccagcaa
cagcgtcttattttctccggcaagcaaatgaatgacgataaaaccgcggcggactacaaa
gtgcaaggtggatccgttcttcacttggtattggctctgcgaggaggtgattcaatccta
acaccttgtgtgtaa

DBGET integrated database retrieval system