KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10706
Entry
Dmel_CG10706      CDS       T00030                                 

Symbol
SK
Name
(RefSeq) small conductance calcium-activated potassium channel, isoform K
  KO
K04944  potassium intermediate/small conductance calcium-activated channel subfamily N member 3
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dme04040]
    Dmel_CG10706 (SK)
Ion channels [BR:dme04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   Dmel_CG10706 (SK)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Ion_trans Sipho_Gp157 DUF501
Other DBs
NCBI-GeneID: 31456
NCBI-ProteinID: NP_726986
FlyBase: FBgn0029761
UniProt: Q7KVW5
Position
X:5340236..5405138
AA seq 927 aa
MSIQKLNDTTNSGYVSSEETDSLLVSSSNPSKGGGRTALLRQVKSNSTNGPTTGASTSSS
GSVSGGGGGSGSGGGSASGSAAGASKPTLMRQDRTSTYLTSPQQSQHARMGSEESMRGGA
SGAAGHDEDVEQGLVRSSIVPDIEVHEEDQEQHSQQLNATTMATMTNNQQQQQPTISIMN
LSLKPGDSHSHSSSPGSHPNLGTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLID
RSASRDSVKSAFQQGNLSGSMAICISNSALPQQQQLQQQYHLQQQQQQHYQLQQHHLHQQ
QLQQSQQQVPPVLITSSPTNGSRIIRQSSQPESSSTAICCGPHSACVGHAHSHSHTVPNV
SLKQLRESSGDGIAGIAADSLRINGGMRPFKQLRKPASTLSIPGSMKTPSIANREQISSG
CNEEAAEALVGIHSDYPRYEMYMEERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFE
KRKRISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAY
HALEVQLFMIDNCADDWRIAMTWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTI
GTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSIGALNRINFNTRFVLKTLMT
ICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNSMWLTAITFLCVGYGDIVPNTY
CGRGITLTCGMVGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRE
TWLIYKHTRLVKRVNPGRVRTHQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTV
YEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSRCLTQHQERIEQRRNFLHPD
TAAVAPIQAPTPQSMFNAAPMLFPHSS
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgtcaattcagaagcttaacgacaccacaaactcgggctacgtgagttccgaggagacg
gactcgctgctggtgagcagctcgaatccgtcgaagggcggcggtcggacggctctgctc
cgccaggtgaagagtaactcgacaaatgggccaacgacgggggcgtccacatcgtcctcg
ggatcggtatcgggcggcggtggtggatccggttccggtggcggatcagcatcgggctca
gcagctggggcttccaagccaacgctaatgcgtcaggatcgaacatccacctacctgaca
agtccgcagcagtcgcagcacgcgagaatgggttccgaggagagcatgcgaggtggagcc
agcggagctgccggacacgacgaggatgtggaacagggcctggtccgtagcagcatagtg
cctgatatcgaagtacacgaagaggaccaagagcaacacagccagcagttaaatgcaacg
acgatggcaacgatgaccaataaccaacagcaacagcaaccgaccatatcaattatgaat
ttaagcctcaagccaggcgatagccatagccatagctccagtccgggtagtcatcccaat
ttgggcacctcatcatatcagaatctggcatcgagcataccgcccagcgtaccgagtcgc
tgcagggcgtgccgcaattgcagtcgacgtgcttccaccacgcccaccacgctgatcgat
cgctccgcctcccgcgacagtgtgaaaagtgccttccagcagggcaatcttagcggctcc
atggccatttgcatatcgaactcggccctgccgcagcagcagcagttgcagcaacagtat
cacctgcaacagcaacagcagcagcactatcagttgcagcaacaccatctgcatcagcag
caactgcagcagtcgcagcagcaggtgccgccggtgctaatcacatcatcgccaacgaat
ggatcacggataatacggcaaagttcacagccggaatcgagcagcacggccatttgttgt
ggtccccattccgcttgcgttggccacgcccactcgcactcgcacacggtaccgaatgtt
tcgctgaagcagctgcgcgagagttccggcgatggaatcgcgggcattgcagccgactct
ctgcggatcaacggtggcatgcggcccttcaagcagctccgcaaaccggcgtcgacactc
tcaattcctggctcgatgaaaacaccttccattgcgaaccgggaacagatctcatctgga
tgcaacgaagaagcggccgaggcactagtgggtatccactcagactaccctaggtatgaa
atgtatatggaagaacgtgctcttactggcggcaatacgtccaggaagccatcaacaaac
tcggccaaacacaaacccaatgtgggctatcgcctgggaaagaggaaagccctcttcgag
aagcgcaaacggatcagcgattacgccctggtcatgggcatgttcgggatcatcgtgatg
gttatcgaaaacgaactgagcagtgccggtgtctacacaaaggcatcgttctactcgaca
gcgttaaaaaccttaatatctgtttcgactgtgattcttttaggacttatagtagcttac
catgctttggaagtgcagttattcatgatagataactgcgctgacgattggaggatcgca
atgacatggcaacgaattagtcaaatagggttagaactttttatatgcgctatacatcca
attcctggcgaatactatttccagtggacgacgaaattggccaataagaataaaacaatt
ggcaccgaaatggtgccatatgacgtagctttatcattacctatgttccttcgattatat
ttaatctgccgcgtaatgctgctgcattcaaagctattcacagatgcatcatcacggagc
attggcgctctcaataggattaattttaacacaagattcgttttaaaaactctaatgaca
atatgtccgggaacggttctattggtcttcatggtctcgctgtggatcatcgcatcgtgg
acgctgcgtcagtgcgaaaggttccacgatgaggagcacgcgaatttgctaaactccatg
tggctaacggccatcacatttctgtgtgtcggctacggcgacattgtgccaaacacgtac
tgtggacgcggtatcaccctcacctgcggcatggtgggcgccggctgtacggctctactg
gtggccgtagtctctcggaaactggagctgacccgtgctgagaagcatgtgcacaacttc
atgatggacacgcagttgacgaaacggctgaaaaatgctgcggcgaatgttctgcgtgaa
acttggctcatttacaaacatacaagactagtaaaacgggttaatcccggccgtgtaaga
acccaccaaagaaagttccttctagctatatatgcgttgcgaaaagttaaaatggatcag
cgcaaactaatggataatgcaaacacaataactgacatggctaagacacaaaacacggtc
tacgagataatatcggacatgtctagccgtcaggatgccatcgaagagcgtttaaccaac
ctagaggacaaaatgcagagcatacaagagcacatggaaagccttccagacctattgtct
cgatgtctgacccagcaccaggagcggatcgagcagcggcggaactttttacatcctgac
acagctgcagttgcccccattcaagcgccaacgccccaatcgatgttcaatgcagcgccc
atgctgtttccacattctagctga

DBGET integrated database retrieval system