KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10757Help
Entry
Dmel_CG10757      CDS       T00030                                 

Gene name
mRpS18B
Definition
(RefSeq) mitochondrial ribosomal protein S18B, isoform A
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Ribosome [BR:dme03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Dmel_CG10757 (mRpS18B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18 RecR TF_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 35299
NCBI-ProteinID: NP_523606
FlyBase: FBgn0032849
UniProt: Q9VIN9
Position
2L
AA seq 204 aa AA seqDB search
MLPIARGIYIGLVNITRNSRGALHTASALRCKAETSTEENNAAATEGEGEDNASGSAPDP
KDRSKPIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG
NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGY
LTYDVPFREYDYSEYYGQEQKQKA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgattgcacgtggaatttacattggactggtcaacattacccggaatagccgg
ggagctcttcacacggccagcgccttgagatgcaaggcggagacttcgactgaagaaaat
aatgcggctgccaccgaaggcgaaggcgaggataacgctagtggttccgcaccagacccg
aaggatcgcagcaaaccaatcccagtggagacctcgattcgatacttaaagagcgccgct
tacaagcaaacctacggcgaggactttgtgtggacgcagtatcggcgcaaccacaagggc
atgtatgcgccgcgcaaaacacgaaagacgtgcatccgccagaaccgtatcagcaccgga
aatccctgtcccatttgccgtgatgaatacctggtgctggactaccgcaacacggagctc
ctggagcagttcatatcgccccacagcggagacgtccttagctactcaaagacaggcctg
tgtcaaaagagccacctgcgtctaatggtcgccgttcagcaagcccgcgactccgggtac
ctaacatacgatgtgcccttcagggagtatgattacagcgagtactacggccaggagcag
aagcagaaagcttaa

DBGET integrated database retrieval system