KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1082
Entry
Dmel_CG1082       CDS       T00030                                 

Symbol
alpha-Est4
Name
(RefSeq) alpha-Esterase-4
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Abhydrolase_6 Peptidase_S9 Ser_hydrolase
Other DBs
NCBI-GeneID: 40906
NCBI-ProteinID: NP_524266
FlyBase: FBgn0015572
UniProt: Q9VIC0
Position
3R:complement(7536687..7538615)
AA seq 541 aa
MSDDYNEDAPVVQTTHGKVRGILLKSLYDEQFYAFDGIPYAVPPLGTLRFKEPHDLKPWH
GIRDCSKPLSKCLQVSTLTKEVEGSEDCLYLNISVKTLNGDPMPVMVYIHGGAFKGGDSS
RRAWGPDYFMKENVVYISIGHRLGPLGFLSLNDPDLEVPGNAGLKDVILALRWIRANAAN
FNGDPERITIFGHSSGSMTVQLLLASPQSEGLFHRAILLAGFSMELNRLPQMEYRLAKHL
GYEGDNVDSQVLEFLLKADPALIVSADFFTPLEKRQGHNMPFKPSIESYSTPNAVLLAEP
IDLQRTTWSNRIPIILGANSGEGMSIFSFVKMNPSWLKEFQCNPERVLPWTLRNRCDPGQ
RRQLGQALIHHFCEAHGHELTVDHTNGLVELFTHGFVHAMDRLIQSRLTYGQAPTYLYRF
DFDSPDFNFYRIRFMGKEQRGVGHVDELGYIFKLPATFKLDKSRPEFTAIRRLVAMFVQF
AATSDPNAPLTKSLVDWKPVTRFGKRMVLNISEELKFIPQPEMPKLKFFDRLYEMAGVPL
F
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtcggacgactacaacgaagatgcccccgtggtgcagacaacacatggaaaagtgagg
ggaatcctgcttaagtccctatatgacgaacagttttacgcttttgatggcatcccctat
gcggttcctccgctgggaaccctgcgcttcaaggagccccatgaccttaaaccatggcac
gggattcgcgattgctccaagccgctcagcaagtgcctgcaagtgagcacattaaccaag
gaggtggaaggctccgaggattgcctttacctgaacatatcagtaaaaactctaaacggt
gatcccatgcctgtgatggtctacatccatggaggcgcttttaagggcggagattcttcg
agacgcgcctggggtcccgactattttatgaaggaaaacgttgtgtacataagcattggt
catcgactgggacccttaggtttcctcagtctcaatgatcccgatcttgaagttcctggc
aatgctggattgaaagacgttatcttggccctccgttggatcagggcaaacgcggccaac
ttcaatggtgaccccgagagaataaccatctttggtcacagctctggcagcatgaccgtt
caactgttgctggcaagtccacaatcagaaggactcttccatagggccatactattggca
ggattctcaatggagctgaatcgcctgccccaaatggagtaccgtctggccaagcatttg
ggctacgagggagataatgtcgatagccaggtcttggagttcctcttgaaggcagatccg
gctctaatcgtctctgcggactttttcactccactggagaagagacagggtcacaatatg
cccttcaagcccagcattgaaagctactccacgcccaatgcagtgctccttgccgagcct
attgacctccagcgaaccacgtggagcaatcgtattcccatcatcttaggcgccaacagt
ggcgaggggatgtcgatttttagcttcgtaaaaatgaacccctcgtggctaaaggaattt
caatgcaacccggagcgggtgctgccttggaccctgagaaatcgctgtgatcctggacag
cggcgccaactgggtcaagcattgatccatcacttctgcgaggcgcacggccatgagttg
actgtagatcacacaaacggattggtggagctcttcactcacggctttgtgcacgctatg
gaccgactaatccaatccagactgacttacggccaggcgcccacttacctttatcgattt
gacttcgactcgccggattttaatttctaccgaattcgctttatgggcaaggaacagcgg
ggagttggacacgtggatgaactgggatacattttcaagctgccagctaccttcaaattg
gacaagtctcgaccagagttcacagccattcgccgattggtggccatgtttgtccaattc
gccgccacctcggacccaaatgctccactcactaaatctctggtggattggaagcccgta
actcgattcggaaaacggatggtcctaaatataagcgaggaattgaagtttattccgcag
ccagaaatgccgaagttgaagtttttcgatcgcctatacgaaatggctggagtaccctta
ttctaa

DBGET integrated database retrieval system