KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10888Help
Entry
Dmel_CG10888      CDS       T00030                                 

Gene name
Rh3
Definition
(RefSeq) rhodopsin 3
  KO
K04255  r-opsin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG10888 (Rh3)
G protein-coupled receptors [BR:dme04030]
 Rhodopsin family
  Vision
   Opsin
    Dmel_CG10888 (Rh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 42398
NCBI-ProteinID: NP_524411
FlyBase: FBgn0003249
UniProt: P04950
Position
3R
AA seq 383 aa AA seqDB search
MESGNVSSSLFGNVSTALRPEARLSAETRLLGWNVPPEELRHIPEHWLTYPEPPESMNYL
LGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSNILVINLAFCDFMMMVKTPIFIYNSFH
QGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNVITRPMEGKMTHGKAIAMIIFIY
MYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFVACIFFFSFVCPTTMITYY
YSQIVGHVFSHEKALRDQAKKMNVESLRSNVDKNKETAEIRIAKAAITICFLFFCSWTPY
GVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQKRCPWLALNE
KAPESSAVASTSTTQEPQQTTAA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggagtccggtaacgtgtcgtcgagtctgtttggcaacgtgtccaccgcgctgcggccg
gaggcgcggctctccgccgaaacgcgtctgctgggctggaatgtgccgccggaggagctg
cggcacattcccgagcactggctaacttacccggagccgcccgaatcgatgaactacctg
ctgggcacgctctacatcttcttcaccctgatgtcgatgctgggcaatggactggtgatt
tgggtcttctccgcagccaaatcgctgcgaactccctccaatatactggtcatcaatctg
gccttctgcgacttcatgatgatggtcaagactccgatattcatctacaatagcttccac
cagggatatgcgctgggtcatctgggatgccagatctttggaatcattggctcctatacg
ggaatcgctgccggtgccaccaatgcgtttatagcctacgatcgattcaatgtgatcact
cgacccatggagggcaagatgacgcatggcaaggccattgccatgatcatattcatctac
atgtacgccactccatgggtggttgcctgctacacggagacttggggccgttttgtgccg
gagggatatctgacatcctgcacctttgactatctcaccgataacttcgatacgcgactc
tttgtggcctgcatcttcttcttcagcttcgtgtgtcccaccacgatgatcacgtactac
tactcccagattgtgggccatgtctttagccacgagaaagcactgcgggatcaggccaag
aagatgaacgtggaatcgctgcgttcgaatgtggacaaaaacaaggagacggcggaaatc
cggatagccaaagcggccatcaccatatgcttcctgttcttttgctcgtggacgccgtac
ggagttatgtcgctgattggcgcctttggggataagacccttttgacgcccggagccaca
atgattcccgcctgtgcctgcaaaatggtggcctgcatcgatccgttcgtgtacgccata
agtcatcccagataccgcatggagctgcagaagcgatgtccctggctggcgctcaacgaa
aaggcgccggaatcgtcggctgtcgcctccaccagcaccacccaggaaccacagcagacc
accgccgcctaa

DBGET integrated database retrieval system