KEGG   Drosophila melanogaster (fruit fly): Dmel_CG10913
Entry
Dmel_CG10913      CDS       T00030                                 

Gene name
Spn55B
Definition
(RefSeq) serpin 55B
  KO
K13963  serpin B
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG10913 (Spn55B)
Peptidases and inhibitors [BR:dme01002]
 Peptidase inhibitors
  Family I4: serpin family
   Dmel_CG10913 (Spn55B)
SSDB
Motif
Pfam: Serpin HMW1C_N
Other DBs
NCBI-GeneID: 49803
NCBI-ProteinID: NP_524953
FlyBase: FBgn0028983
UniProt: Q7JV69
Position
2R
AA seq 374 aa
MFDFNLEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAK
ALHFVSNFPPEVAQTFQFVLEKYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAE
SINFALNDAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEE
RTEEDIFWVGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTG
IYALAEKLKTVNLVDLADKLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFS
NLLESPEGVFVSKVLHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWN
KKNILFAGAFVKAA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgttcgatttcaatttggaatttgcgcgtggaggtgcccgtttcaccagcgaacttttt
cagcttttgagcgctggcgggctcaaggagaacgtcgtcttctcgcccttctccatccaa
acttgcattgccctggcctttgccggatcgcagggtgaaaccgccgacgagatcgccaag
gcactgcacttcgtctccaactttccgccggaggtggcccaaacgttccagtttgtgctg
gagaagtaccgcaacagtaacctgctgcgcgttgccaacaagctgtacgtgcaggagggc
aagcagctgaagcccgcctaccagtcggccatcaaggagcagtatcattcggaggcggag
tccattaactttgcgctcaacgatgccgccgcccaggccatcaatgcctgggtgaatgcc
aagactcagggcaagattacggagctggtcagcgcggactcgttctcggacaacaccagg
ctggtcctgctcaatgccctccacttcaagggcagctgggcgcacaagttcagcgaggag
cgcaccgaggaggatatcttctgggtgggcgaggaggagcaggttaaaatcaactacatg
aaccagaaggccaagttcaactatggcttcttcgaagatctgggctgcactgccctggag
atgccctaccaggactctgacctctccatgttcgtgctgctgccgcaggagcggacaggt
atttacgccctagccgagaagctcaagactgtgaacctggtggatttggccgacaagttg
accgtggaagaggtccatgtcaagttccccaagtttaaggtggactactccctggaattg
gccgagaaactgaagcagctgggcatcacgaaaatgtttacggaccaagctgagtttagc
aatctgctggaatcccccgagggcgtctttgtgtccaaggtgctgcacaaggccaccatc
gaggtgaatgaggagggcacggaggcggcggctgccaccggcatgatcatgatgacccgc
atgatgaccttcccgctgcagttccaggcggaccggcccttcctctacgtcatctggaat
aagaagaacatcctcttcgctggcgccttcgttaaggctgcctaa

DBGET integrated database retrieval system