KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11061
Entry
Dmel_CG11061      CDS       T00030                                 

Gene name
GM130
Definition
(RefSeq) golgi matrix protein 130 kD
  KO
K20358  golgin subfamily A member 2
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG11061 (GM130)
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    Dmel_CG11061 (GM130)
SSDB
Motif
Pfam: GOLGA2L5 Occludin_ELL
Other DBs
NCBI-GeneID: 37524
NCBI-ProteinID: NP_611642
FlyBase: FBgn0034697
UniProt: Q9W289
Position
2R
AA seq 795 aa
MPDDTQDAKAQKLAAARKKLKEYQQRASNNNGQPGAEEPVAATTQSHSSTVSISSNLSER
SDSEINVNGGGAGGTQPPEQSALPTAASYFAQNESEHNGGLADASSLQAIQVIIAEKAQL
NAELTKVRLACRERELELEELRILKDQNQLRLEQLQQHCQDQQSTGEQQRQQYAQLQAQL
LQSQAQIKDQQSHLNELEAQLKQSNQHQEELQQQLSQKSNELEMAQLKLRQLSDESSVTT
DNRVESLVQTQYMYEQQIRDLQAMVGQLTQDKEQAAGQYQNYVQHQSGEIAKLNERNTEL
SEVLNSLRERERQLVEHVGALERDIQKNISLQAQFKEASQVQPSKEETSEQKALKDELAV
LKEQIENFEFERHEFQLKIKSQDDQLQLKNSALDELEKQLERLQAEQPDQSKLLATMESD
KVAASRALTQNVEMKNQLDELQQRFVQLTNDKAELVIRLDSEEFANREIRQNYNSMEQKL
QANEERFKFKDEEMIRLSHENVELQRQQLMLQQQLDRLRHYEAKAYHAGEETEKENGADA
PENEAEEAKEVGLLHNHSHDHSHQHSDGHCHDNDHDHSHEHNHHNAGDHGHPHDHPHDHT
HDHSHSHPHDHQHDHPHDHGQNHAHRQAAETLPTAEAVERLQSRFTTLISQVADLTEEKH
SLEHLVLQLQSETETIGEYIALYQTQRRMLKQREYEKAAQMRLLQAEREQLREKIEALNK
LVVSLGVELPADAAQAKQPEAAAGSEHTPGEGENSQQIINKIQDIISEIKENTEQPSHNH
AGDHLNCCMGKFEVV
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgcccgatgacacgcaggatgccaaggcgcagaagttggccgcggcaaggaaaaagctg
aaggagtaccagcagcgcgccagcaacaacaatgggcagccgggagcagaggagccggtg
gctgccaccacgcaatcgcactcgtccactgtgagcatatccagcaatctgtcggaacgg
tcagacagcgagataaatgtgaacggtggaggagcaggtgggacgcagccgccggagcag
tctgccctgcccacagccgcttcttattttgcccaaaacgagtcggaacacaatggtgga
ctggcagatgcctctagcttgcaggccatccaggtgatcatcgctgaaaaggcccagctc
aatgcggagctgaccaaggttcgcctggcttgccgggagcgtgagctagagctggaggag
cttcgcatcctcaaggatcagaatcaattgcgtctggagcagctacaacagcactgccag
gatcaacagtcgaccggtgagcagcagcgacagcagtacgcgcaactccaggcacaactg
ctacaatcgcaggcacaaatcaaggaccaacagtcgcatctcaacgaactagaggcccag
ctaaagcagagcaaccagcatcaagaggaactgcagcaacagctttcccaaaaatcgaac
gaactcgagatggcgcagctgaagctgcggcagctctcagacgagtctagcgtcaccaca
gacaaccgagtggagtcgctggtgcaaacacaatacatgtacgagcaacagatacgcgac
ctccaagcgatggtgggtcaactaacgcaggacaaggagcaggcagctggtcagtatcaa
aactatgtgcagcatcagagtggcgagatcgccaagctcaacgaacgaaacacagaactc
tcagaggtactgaactcactgagggagcgagaacgccagcttgtggagcacgtgggcgcc
ctggagcgggatatacaaaagaacatcagcctgcaggcccaatttaaagaggccagtcaa
gtgcagccatccaaggaagaaaccagcgagcagaaagccttaaaagatgaactggctgtc
ttgaaagagcagatcgaaaacttcgagtttgagcgccacgaattccagctgaagatcaag
tcgcaggacgatcagctgcagttaaagaactcggctttagacgagttggaaaagcaactc
gaacgcttgcaagctgagcagcccgatcagtccaagctgttggccaccatggagtcagac
aaagtggccgcatcgcgtgccctaacccagaatgtagagatgaaaaaccagttggacgaa
ctgcagcagcgatttgttcagttgacaaacgacaaagccgagctggtcatccgcttggat
tcagaagagtttgccaaccgagaaatccgccagaactacaacagcatggagcaaaagctt
caagcaaatgaggagcgctttaagttcaaggatgaggaaatgattagactatcgcacgag
aacgtggaactacaacgtcagcagttaatgttgcaacagcagctggaccgtctcaggcat
tatgaggcaaaagcttatcacgccggtgaggaaaccgaaaaagagaatggagcagatgca
ccggaaaacgaagcagaggaagcgaaggaagttggtcttttgcataatcattcgcacgat
cactctcatcagcattccgacggtcattgtcatgataatgaccacgatcattcccatgaa
cataaccatcataatgctggtgatcatggtcatccacatgatcatccgcacgatcacaca
catgatcattcacatagccatccacacgatcatcagcatgatcatccacatgatcacggc
cagaaccacgcccacagacaagcagctgaaacgctgcccaccgccgaggccgtggaacgc
ttgcaatcgcgtttcaccacactgatcagccaggtcgccgacttgacggaggagaagcac
agcctggagcatctggtgctccagctgcagagcgaaaccgaaacgattggcgagtacatt
gccctctatcaaacgcagaggcgcatgctaaagcagcgtgagtacgagaaggccgcccaa
atgcgtctcttgcaagcggagcgagagcagctgcgcgagaagattgaggcactaaacaag
ctggtggtcagtttgggcgtggagctacccgcagatgccgcccaggcaaagcaaccagaa
gcggccgcaggtagcgaacacactcctggcgaaggtgaaaactcgcaacagatcatcaac
aagatacaggacattatcagcgagatcaaggagaacacggagcagccaagccacaaccat
gcaggagaccatctcaactgttgtatgggcaagttcgaggtagtctaa

DBGET integrated database retrieval system