KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11063
Entry
Dmel_CG11063      CDS       T00030                                 

Gene name
jub
Definition
(RefSeq) ajuba LIM protein, isoform B
  KO
K16682  LIM domain-containing protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04391  Hippo signaling pathway - fly
dme04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    Dmel_CG11063 (jub)
   04392 Hippo signaling pathway - multiple species
    Dmel_CG11063 (jub)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dme03019]
    Dmel_CG11063 (jub)
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG11063 (jub)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dmel_CG11063 (jub)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     Dmel_CG11063 (jub)
SSDB
Motif
Pfam: LIM
Other DBs
NCBI-GeneID: 32351
NCBI-ProteinID: NP_572930
FlyBase: FBgn0030530
UniProt: Q9VY77
Position
X
AA seq 728 aa
MTTQRTQTQARNPGNSDSDYETLMQRLHIGGGGGAGVGGGGGSGGPGDGGVAMRSYQRSP
GAIENYLQESQQQQQQHQMQQMQQLHHNQDYKLYERGNIIAASKYATPRPVEQIQHTHNG
SAQIYAPTAQILGQRIAPQKHSPVYENLEFYGQFDSNHKRAQPQSPGSRQSAILNGYLLM
QPIRAGRFAHTPVPENQGSASLGTTRAAGGPPPPSGRSAALGPTGDLEEHAAPIYENIIP
HSGQRAQPQASPATATMYQEMQPTSNSSGSSSTAGLDLNALLASPMHQRSISSNTASSSS
LGSPTQRYRNLSLPSHLSPVPTAQSVAKLQQHTPVKSPGGAINVSVNPNYIEDINSSDYV
CMTANLHRNTAAGLATGRAAATGAPAQRTVQEPPIITSSLAMGMATAAPPTTSNAPTSAA
AAPAAPTSTASLRATPIAMTAPLAVATSPTPSQGSTAVNAALKPRRGLTKNLLPYSVTPP
RPAGPTEAQRKIEELTRQLEEEIEQSEEHGEYFGICHTCGEKVKGAGQACQAMGNLYHTN
CFICCSCGRALRGKAFYNVHGRVYCEEDYMYSGFQQTAEKCAICGHLIMEMILQAMGKSY
HPGCFRCCVCNECLDGVPFTVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRV
VSMDKDFHVDCYICEECGMQLTDEPDKRCYPLDGRLLCRGCHLQRLALQSSPHARHQEPV
CASYQYMG
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgaccacccagcggacgcagacgcaggcgaggaatcccggcaactccgattccgactat
gagacactgatgcagcgtcttcacatcggtgggggaggtggtgctggtgttggaggaggg
ggcggcagtggtggccctggagacgggggcgtggccatgcgaagctaccagcgctcaccg
ggcgccattgagaactacctgcaggaaagtcagcagcaacagcagcaacatcagatgcag
caaatgcagcaactccatcacaatcaggactataagctgtacgagcgcggcaacatcatt
gccgcctccaaatacgccacgccccgtccggtggagcagatacagcacacgcacaacgga
agtgcacaaatctatgcaccgaccgcacagattctgggccagcggattgcaccgcagaag
cattcgccggtatatgagaacttggagttctacggtcaattcgattcaaaccacaagagg
gctcagcctcaaagtcccgggagcaggcagagcgccatattgaacggctatctgctgatg
cagcccattcgggctgggcgctttgcacacacgccggtgccagagaatcaaggatctgca
tcgttgggaacgaccagagcagcaggaggaccaccaccaccatcgggacgttctgctgct
ttgggtccaactggcgatctggaggagcatgctgcgcccatatacgagaacatcattcca
cactctggccagcgggcacagccacaggcctcgccggccaccgccaccatgtatcaggag
atgcagcccacgtccaactcctcaggcagttcgtccaccgccggtctggatctcaatgcg
ctgctggcctcgcccatgcaccagcgaagcattagcagcaacacggccagttctagctcc
ttgggatcgccaacgcaacgatataggaatctatcgttacctagccacctaagtcccgta
cccaccgcgcagtcggtggccaaactgcagcagcacacgcccgttaagtcgcccggcggc
gccattaatgtctccgttaatcctaactatatagaggacatcaatagctctgactacgtt
tgcatgacggcgaatctgcacaggaatacggcagcaggattggctaccggcagggcggct
gcaacgggagcccctgcccagcgaactgtccaggaaccaccaataataacgtcatcactg
gccatgggcatggccacggcagctccaccaaccacatccaatgcaccgacatcagcagca
gcggcaccagcagcaccaacatccaccgcttccttgcgggcgacgcccattgcgatgacg
gctcctctggcggtggccacatcacccactccctcgcagggcagcacagccgttaatgct
gccttgaaacccaggagaggtctcaccaagaatctgctaccgtatagcgtcaccccgccg
cgtccggctggcccgacggaggcgcagcgcaagatcgaagagctcacacgccagctggag
gaggagatcgaacagagcgaggagcacggcgaatactttggcatttgtcacacatgcggc
gagaaggtgaagggtgccgggcaggcttgccaggcgatgggcaatctgtatcacaccaac
tgcttcatctgctgctcctgcggacgggcgctgcgaggcaaggcgttctacaatgtgcat
ggtcgggtctattgcgaggaggattacatgtactcgggcttccagcagacggcggaaaag
tgcgccatctgtggccatctgatcatggaaatgatcttgcaggccatgggcaagtcgtat
catccgggctgcttccggtgctgtgtgtgcaatgagtgcttagacggggtgcccttcacc
gtggacgtggaccacaagatctactgcgtcaacgactaccatcgaatgtttgcgcccaag
tgcgctagctgcggcaaaggcatcacacccgtcgagggcaccgacgaaactgtgcgcgtc
gtctcgatggacaaggacttccacgtggactgctacatctgcgaggagtgcggcatgcag
ctgaccgatgagccggacaaacgctgttacccgctggacgggcgcctgctctgccgcggt
tgccacctgcaacgtctggcgctgcaatcctcgccacacgctcgtcatcaggagcccgtc
tgcgcttcgtaccagtatatgggataa

DBGET integrated database retrieval system