KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11147Help
Entry
Dmel_CG11147      CDS       T00030                                 

Gene name
CG11147
Definition
(RefSeq) uncharacterized protein, isoform A
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC_tran AAA_21 ABC2_membrane_2 RsgA_GTPase SMC_N ArgK CLP1_P AAA_16 ATP-synt_ab
Motif
Other DBs
NCBI-GeneID: 33803
NCBI-ProteinID: NP_608954
FlyBase: FBgn0031734
UniProt: Q9VMM9
Position
2L
AA seq 711 aa AA seqDB search
MAAVEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLN
GGEVVVLGAKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKF
KLLKELLQLPPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDF
LVETTRNSKLAVIITTHYIEEAKQANCIGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLI
LSQRQGNEDELAQIMDHNKNQALPAAVLPPEVIDTHEPNMPEKQPIPFEEPLNENRKKIF
FTTKGRVKALMTKNFVQLFRQPSGIIFMLLFPIIQLTCFYLAIGKTPTNLEIGVYSGEVE
NYGECFDENLVTVYKDSDNESCLFNKLSCRYIRVLGDDVATRKYYASEADALNDAKRATT
VGYLHFAQNFSDSILSVMEDGIHSSDGAVDHAELSIHIDMTDQQVAYFMQRKLRDKFSTF
MRSVVKDCNVSTAIVDLPVQFQEPIFGSTDIEFQQYCAPGVVMTMVFFLATLMTAAVFIS
ERMDGIWDRTLLAGVSATEMLWAHLLTQLIIMALQSFEVIMYIGLVFDTYNNGDTTTLIG
LLTLTAFCGMLFGLFISVFCKSHTEANFVATGAFYPMIILCGLLWPLESMPQFLQDLVMV
LPFTIPSISARNVIEKGWSITHEKVYNGFLVMAGWTIIFFVLCLIGIRRKA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgttgaggtacggaatggctataagtactatggctccaaatcaaatcccaag
attgtgcttaaccagctgaatatgaacgtgatgcgtggttctatatacggattgctgggt
gcctccggatgcggaaagacaaccctgctctcttgcatcgtcggccagaggcgcctcaac
ggcggcgaggtcgtcgtgcttggggccaagccaggagagcctggtagcggcgtgccagga
tcccgggtgggattcatgccccaggagattgccctggtcgaggagatgaccgtcaaggag
acaatcttctacttcggtcgcatctacggcctgacagacgaacgcatccgggagaagttc
aagctgctcaaggagctgctgcaactgccaccggctaggcagatgatcaagcagtgcagc
ggtggacagcagcgacgcttgtccttcgcctgcgccatgatccacgatccggagcttctc
attctggacgagcccactgtgggattggatccaatgctgcgtgaaaaaatctgggacttt
ctcgtggagacgacgaggaatagcaaattggctgtgattataaccacccattacatagag
gaagccaaacaggcaaattgtattggtcttatgcgcaatggtgttctattggctgaggat
actcctaccaacatcatgatcaagttcggaactcagtcgatcgaggacgccttcctcatt
ctgagccagcggcagggcaacgaagatgagttggcccaaatcatggatcacaataagaat
caggctttgccggcagctgtgctgccccctgaggtaatagacacacacgagcccaacatg
ccggaaaaacagcccatcccgttcgaggagcccctaaacgagaatcgcaaaaagattttc
ttcaccaccaagggcagggtaaaggcactgatgacaaagaactttgtacaactctttaga
caaccctcgggaattattttcatgctactatttcccatcatacaactgacgtgcttttat
ctggccattggcaagacgcccacgaatcttgaaataggagtttattccggcgaagtggag
aactatggggagtgctttgatgaaaacctggtcacagtctacaaggatagcgacaacgag
agctgtctattcaacaagttatcctgcagatacatacgcgtgttgggtgacgatgtggcc
acgcggaaatactatgccagcgaagcagatgctctgaacgatgcaaagcgggccacaacc
gttggctatttgcactttgcccagaacttcagcgattcgattctctcggtaatggaggat
ggcatccactccagtgacggagctgtggaccacgccgagcttagtatccacatcgatatg
acggatcaacaagttgcgtacttcatgcagcgcaaacttcgtgacaagttcagtacattc
atgcgcagtgttgtcaaggactgcaatgtatctacggccattgtagatctgcccgtccag
ttccaggaaccaatctttggcagcacggacatcgagttccagcagtactgtgccccagga
gtggtaatgaccatggtcttcttcctggccactttgatgacggctgcagtgttcatttct
gaacgcatggatggcatctgggatcgaactctattggcaggtgtctcggccaccgaaatg
ctgtgggctcatcttctaacccagctcatcatcatggccctgcagtcgttcgaggttatt
atgtatattggcctagtgttcgatacttacaataatggggataccacaacgctcattgga
ttgctaacactgaccgcattttgtggcatgttgttcggtctcttcatatccgtattttgc
aaatcgcatacagaggcaaactttgttgctactggtgctttttatcccatgatcatactg
tgtggactgctgtggcctttggagagcatgccgcagtttctgcaggatctagtgatggtg
ctacccttcaccattccctccatctccgctcgaaatgtgatcgagaagggttggagcatc
acccatgagaaggtctacaatggtttcctggtcatggccggctggacgatcatcttcttc
gtgctctgcctgatcggcatcagacgcaaggcgtaa

DBGET integrated database retrieval system