KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11172
Entry
Dmel_CG11172      CDS       T00030                                 

Symbol
NFAT
Name
(RefSeq) NFAT nuclear factor, isoform B
  KO
K17335  nuclear factor of activated T-cells 5
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG11172 (NFAT)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    Dmel_CG11172 (NFAT)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG RskA MAT1 CD20 DUF3824 FHIPEP
Other DBs
NCBI-GeneID: 32321
NCBI-ProteinID: NP_001096974
FlyBase: FBgn0030505
UniProt: A8JUV3
Position
X
AA seq 1457 aa
MRFTYNQYKHYESGYRIPSKMHNLSHNNNNNSNNNNNGGGHTNNNNNGNNSGHHYAHHNN
SNNGGNNNTNFQAYQHHYKSNFGMRMTMSTNSTMSARIHRKGFRIPSKRQPGKGLPGKLH
TITRTGPGKMVPGKRIPQRPHPPPCDNSNDSGLGFDQHTELRSSAGAGGVTDPAANGGSG
SNSGQRSSLLVNSALTNTVAAAAAAAAAAVASNTLQQHQQHHQQQQQQQQQQQQQQQQQQ
QQQQQQQHSPQQHLIRAIPVSRSRNNTKVMAHCLEDLDLISASSEDSSTIATPAGLDEDT
GFVNDTKTTTTGGNSSSDPFGGVFQATEAAVAAAVNAFNLQQQQHSVQQQQHQLFQYNGL
LLQPQQQLQQQQSHHQQQQQQQQHHRHGKHIKRKKLECNQVELDNDDACSEDEFIRKIAS
SVTMSPTLEATPSPPPIVASVAPATTIVSLLPLISSGNSNNNNNNNNIETKFISARNVTR
VANKRQPTTPLNSVASSNDGQVQLEILSQPEQQHRARYQTEGSRGAVKDRSGNGFPIVRL
TGYDKVAVLQVFIGTDIGRVAPHMFYQACKVAGKNSTQCNEKKVDGTMVIEIDFKPETDM
TITCDCVGILKERNVDVEHRFPEHLAQKNKKKSTRCRMVFRTQLTRDDGTTETLQVCSNP
IICTQPPGVPEICKKSLNSCPVDGGLELFIIGKNFLKDTHVVFQETYDSVNGDDPATEIA
VRQQLIGGTAALWEQSVLPDKEYLHQTHLICTVPPYLHQNILKPVQVQVSIVSSGKKSEP
HTFTYTAKGQYTTLAAASTLSNTIHAQDVSGFMDTTSASNASGSSGWSAAGGSGNNTSTG
DNVEAKHEIDSGMMPPPITTQIPMGVRRSSLPSVTPMITDQQLVHLNAVAASAEALKTEL
DDSNSHSPLTGESTPDSPNAALQYHRFARKPSLDTIMYDQSNSLPGFPTVVAPATAAAVA
AAVDIDPTAVAVAVELAVKNEIVKHVVQQHQQMQEQMHEQQQQQQQQQQQQQQQQQQQPQ
QQQQQQVHKFIDELTKSTSVVSSNGTTEPALFTTSAVIDHALTDILQAKVGIAPPNVVLE
RSLSLSSTNSSSSMSGSESSPNSSPLTQDIILNSEPAAALAGAAALGGPAPVDVTGGLST
DIIMNPAVSPSTILCSANGAATAVVPNILAPHQVTMANSILNDIAMQPEPTQQDAAVAAL
ALSNIMMSPPTAASGVGVGDTLPPTPATMQPEVAATATSTAVSNMIIKAAADFITTQEQE
QHHYHHHGRIHSHSPQAAVGVSGNPAETASDPLVDLLLNHSNTPETAAAAAAAVAVEAAN
FQSMNHSHHSHHGHHGHSHGHGHSRVTGHVSGHVTSHHRGHHLPVVPPTPQESLIVALAS
ENALQKSVATAAVTTNGAVMTQQASAPNTAGSILPAAVGAVAAAAAVAVQPPIPQELTTM
SDQDLISYINPSTFDQL
NT seq 4374 nt   +upstreamnt  +downstreamnt
atgcgattcacctacaatcagtataaacattatgagtccggttatcggattccatctaaa
atgcataatctgagccataataacaacaataatagtaataataataataatgggggtggc
cacaccaacaacaacaacaatggcaacaatagtggccatcactatgcccatcacaataat
agcaacaatggcggcaataacaacacaaatttccaagcctatcagcatcattacaaaagt
aatttcggcatgagaatgaccatgtccaccaattccacaatgagtgcgcgtatacatcga
aaaggatttcgcataccatcgaaaagacagccgggtaagggattgcccggcaagttgcac
accataaccaggacgggtcctggcaaaatggttcctgggaagcgaataccacagcgaccc
catccgccgccctgcgacaactcgaacgacagtgggctgggtttcgatcagcacacggag
ctgagatcctcggcaggagctgggggcgttactgatccggcggccaatggaggcagtggc
tccaactctggccagcgatccagtttgctggtcaatagcgctttaaccaacacagtggct
gctgcagcagccgcagcagctgccgcggtggccagcaacacgttgcagcagcatcagcag
caccatcaacagcagcagcagcaacagcagcaacaacagcagcagcagcagcaacaacaa
caacagcagcagcagcaacaacattcaccgcagcagcatttaatcagagcgatacctgta
tcaagatcgcggaacaacacgaaagtgatggctcactgtctggaggatctggacctaata
tcggcgtcctcggaggacagctcgaccatcgcaacgccggccggtttggacgaggacacg
ggctttgtgaacgacaccaaaacgacgacaaccggtggcaatagtagttcggatccattt
ggaggcgtctttcaggcaaccgaggcagccgtggcagcagccgttaatgccttcaacttg
caacagcagcagcattcggtgcaacagcaacagcatcaactctttcagtacaacggattg
ctgttgcagccgcagcagcaattgcagcagcaacagtcgcatcaccaacaacaacaacaa
cagcaacagcatcaccgccatggcaagcatatcaaacgcaagaagctcgagtgcaaccaa
gtggaactggacaacgatgatgcctgcagcgaggatgagttcattcgcaagattgccagt
tcggtaacgatgtcacccacgcttgaggccacgccctcgccgccgcccattgtcgcctcc
gttgcacctgccacgaccattgttagccttctgccgctcatcagcagcggcaacagcaac
aacaacaacaacaacaacaacattgagacaaaattcatatcggccaggaatgtcacgcgt
gtggcgaacaaacgtcaacccactacaccgctgaacagcgtcgccagctccaacgatggc
caggtgcagctggagattttgtcgcagccggagcaacagcaccgggcacgctatcaaacg
gagggcagccgcggtgccgtcaaggatcgcagcggcaatggattcccgatcgtccgactg
accggatacgataaggttgccgtcctccaggtcttcatcggcacggacattggacgcgtg
gcaccgcacatgttctatcaggcctgcaaggttgccggcaagaactcgacgcagtgcaac
gagaagaaggtcgacggcaccatggtcattgagatcgatttcaagcccgaaacggacatg
accatcacatgcgattgcgttggaatcttgaaggaacgcaatgtggatgtggagcaccga
tttcccgagcatctggcgcaaaagaacaagaagaaatcgactcgctgccggatggtgttc
cgcacccagctgacccgtgacgatggcaccaccgagaccctccaggtctgctcgaatcca
atcatctgcactcaaccacctggcgtgccggaaatatgcaagaaatccttaaactcatgt
cccgttgatggcggcctcgagcttttcattatcggcaagaactttctgaaggacacacac
gtggtgtttcaggagacatacgacagcgtcaacggtgacgatccggccacggaaattgca
gtgcgccagcagctcatcggcggtacagccgctctttgggaacagagtgttctgccggat
aaggagtaccttcaccagactcatctgatatgcacggtgccaccgtatctgcaccagaac
atcctgaaaccggtccaggttcaagtgtcgatcgtctccagcggcaagaagagcgaaccg
catacgttcacctacacggccaagggacagtacacgacgctggcggcggccagcacgtta
agtaacacaatccacgcccaagatgtgagcggtttcatggacaccacatcagcgtccaat
gcgagtggctccagtggttggagtgcggcaggcggttccggcaacaatacatctacaggc
gataatgtggaggccaaacacgagatcgattcgggcatgatgcctccgcccattaccacc
caaataccgatgggcgttcgacgctcctcgctgcccagtgtcacacccatgatcacggac
caacagctggtccatctcaacgcagtggcggccagtgccgaggccctgaagacggaactc
gacgacagcaactcgcatagcccactgaccggtgaatccacaccggatagccccaacgca
gccttgcagtatcatcgctttgcacgaaagcccagcctggacaccattatgtacgatcag
tcgaacagtctgcccggtttcccgaccgttgtggcgccggctacagctgccgccgtggcc
gctgcagttgatattgatccgacggcggtggccgtggcggtggaactggccgtaaaaaat
gagattgtcaagcatgtcgtacagcagcaccagcagatgcaggagcaaatgcacgagcag
cagcagcagcaacagcagcagcaacaacaacaacaacagcagcaacaacaacaaccccaa
cagcagcagcagcaacaggtgcacaagtttattgacgagctgaccaaatccacatcggtg
gtttccagcaatggtaccaccgaaccagctctgttcaccacctcggcggtgatcgatcat
gccctgaccgatattctgcaggccaaagttggcattgcgccgcccaatgtggtgctggaa
aggagtttgtccctaagctccacaaattccagcagctccatgagcggcagtgagagttcg
ccgaatagttcacctttgacgcaggatatcatactcaattcagaaccggcagcagctctg
gccggagctgctgccttgggtggcccggcgcctgtcgatgtcaccggtggtctgtccacc
gatatcattatgaatcccgccgtttcaccatcgactattttgtgctccgcaaatggagcg
gccactgccgtagtgccgaatatactcgcacctcaccaagtgaccatggccaactccatt
ttgaacgatattgccatgcagccggaaccaacacagcaggatgcagcagtagcagccttg
gcgttgagcaacatcatgatgagtccacccaccgcggcatcgggtgtgggagttggtgac
acactgccaccaacaccagctactatgcagccagaggtcgcagccactgccacatccact
gcggtcagcaacatgattattaaggcggcggcggactttataaccacccaggagcaggag
caacaccactaccatcaccacggtcgcatccactcccattcgccacaggcagctgtcgga
gtgagcggtaatcctgccgagacggcatcggatccattggttgacctgctattgaaccac
tcaaacacaccagaaacagcggctgctgccgctgccgcagtagctgtagaagcagccaac
ttccagtcgatgaatcacagtcaccacagccatcatggtcatcatggtcacagtcacggc
cacggccatagtcgcgtcacaggacacgtatccgggcatgtgaccagccaccatcgtggt
caccacttgccggtggtgccgccgacaccacaagaatctctgatcgttgcgctggccagc
gagaatgctctgcaaaagtcggtggccaccgccgcagtgaccaccaatggagcagtgatg
acgcaacaggcatctgccccgaacacagcgggtagcatacttccggcagcggttggagcg
gtagctgcggcggccgccgtggcggtgcagccgcccattccccaggagctgaccacgatg
tcggatcaggatctgatcagctacatcaacccgagcacctttgatcagctttaa

DBGET integrated database retrieval system