KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11210Help
Entry
Dmel_CG11210      CDS       T00030                                 

Gene name
CG11210
Definition
(RefSeq) uncharacterized protein
  KO
K21989  calcium permeable stress-gated cation channel
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG11210 (CG11210)
Transporters [BR:dme02000]
 Other transporters
  Pores ion channels [TC:1]
   Dmel_CG11210 (CG11210)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RSN1_7TM PHM7_cyt RSN1_TM
Motif
Other DBs
NCBI-GeneID: 35779
NCBI-ProteinID: NP_610351
FlyBase: FBgn0033259
UniProt: Q6NP91
Position
2R
AA seq 760 aa AA seqDB search
MVMSENSNISYCQAVANRTSFFTTAYNGIPETLILNTIFWVLLILLFTVLRHQAGDFGRL
ALVNSNGSKKRWTEIFYSRAASVVDPQPSTSTQVSPRPSTTSQGVPDSTPLSPIQPEEGL
FGWIRVTLKLRKETILLHTGPDAVHYLSFQQHLMAVMALVTIVSLVIILPVNFLNGPKEN
PYDVNAFGRTTMANLSPDSPWLWVHTIITILYIPLVVLIMRRASGRNAFKKAATRTIMIS
NISSSDRNKTVVRNYMQELFPDVTIENVSIAYNISRLYVRNAEFERVHEARLYCEHHRNR
DTLMVKPEMCSCKKENAYEYYQREERKLSGDVARLRASTMNEPLDIAFITVSTVQEAQNI
VTHFTPGTYRQWHLVFAPSPDDLFWENLNVNKSHWYLKFFCVNAVLFLVLFFLSTPAMVV
SLLNSRPWVKETEGKISPLVADFLPTLMLWTLSALMPVIVAISDKWMRHYTRSKQNYSIM
TKCFGYLLMMIMILPSLGLTSAQALLEWGFLNQTDRWQCIFLPDRGSFYVNYIITAAFIG
TALELLRFPELIVYIWSLLKAKSKAETPYIRKAILIEFPFGTHYAWTTLVFTIAIVYSVA
CPLIMPFAMIYICLKHFVDRHNLYFAYGPSNMISRKGGKIHSTAVTMTKFSVVILVLVMA
MICFFRGDNGMARFLLLIISLAITLTLFTFMSPIKRCAATRRPSIVEIAGPAPIYVPDVL
KDNGIRTSSVRPSAAAFGGYGSDSVSEYDSSQYSVNSVEA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgtcggaaaacagcaacatttcctactgccaggcggtggccaatcgcacttcg
ttctttaccaccgcctataatggcattccggaaaccctaatactcaacaccattttctgg
gtactcctgatccttttgtttacggttctgcggcaccaggccggtgactttggacgtcta
gcgctggtcaacagcaacggcagcaagaagcgctggacggagattttctactcgcgcgcc
gccagtgtggtcgatccccagccgagcacttcaacgcaggtatcgcctagaccaagtacc
acctcccaaggagttcccgactccacgcccttgtcccctatccagccggaggaggggctt
ttcggctggatacgggttacgctgaagctgcgtaaggagaccatactgctgcatactgga
ccggatgccgtgcattacttgtcctttcagcagcacctgatggctgtaatggcattggtt
accatagtctccctggtcattattctgcctgtgaatttcctgaacgggcccaaggaaaat
ccgtacgatgtgaatgccttcggacgcaccacgatggcgaatctttctccggattcacct
tggctgtgggtgcacacgatcatcacgattctgtatattccgctcgtagtgctcatcatg
cggcgcgcctcgggacggaatgccttcaaaaaggcagccacccgcacgattatgatttca
aacatatcctccagcgatcgcaacaagactgtggtacggaactatatgcaggagctcttt
ccggacgtcaccatcgagaatgtgtcaattgcgtacaacatttcacgactatacgtaagg
aacgccgagttcgagcgagttcatgaagcacgattgtactgcgagcaccataggaacagg
gatactctcatggttaaaccagaaatgtgttcctgcaaaaaggagaacgcctacgaatat
tatcagcgagaggagcgcaagttgtccggcgatgttgcccgtctgcgtgcttccaccatg
aatgagcccctggacattgcgtttatcaccgtgtccactgtgcaggaggcccagaacata
gtaacgcactttacaccgggcacctaccgccaatggcacttggtgttcgctccgtcgcct
gatgatcttttttgggagaacctaaatgtgaataagagtcattggtacttgaaattcttc
tgtgtgaatgcagtgctttttcttgttctcttcttcctgtccacaccggccatggtggta
agccttctaaacagtcgaccatgggtaaaggaaacagagggtaagatctcgcccctcgtt
gccgacttcctgcccacattgatgctctggactctttcggctctaatgcctgtgattgtt
gccatttcggacaagtggatgcggcactacacgcgctccaagcagaactactcaatcatg
acgaagtgctttggctatctgcttatgatgatcatgattctgccttccctcggactgaca
tcggcacaggcgctgctagagtggggattcttaaatcagactgatcgctggcagtgcatt
ttcctgccggatcgcggctccttctatgtgaactacatcattacggctgcgtttatcggt
acagcgttggagctgctacgcttcccggagctgattgtatatatctggtcattgctaaag
gcgaaatccaaggccgaaacgccgtacattcgtaaggctattctaatcgagtttcctttc
ggaacgcactacgcctggacaacgctcgttttcaccatagccattgtgtatagcgttgcc
tgtccgctgattatgccgttcgccatgatctacatctgcctaaaacacttcgtggatcgc
cacaacctctactttgcctacggtccgtcaaacatgatatcacgcaagggtggtaagatc
cactccactgcagttacgatgacaaagttctcggtcgtgatcctggtactggtcatggcc
atgatttgtttcttccgtggcgataacggaatggctcgattcctgctgcttatcatcagc
ctggctatcacattgactttgttcacctttatgtcaccaattaagcggtgtgcggccacg
cgccgcccaagcattgtggaaattgccggtccggcacccatctacgtgcccgatgtgctg
aaagataatgggataaggaccagcagtgtgcgaccttcggcggcagcatttgggggctac
ggctccgacagcgtgtccgagtacgacagctcacaatacagcgtcaacagtgttgaggcg
taa

DBGET integrated database retrieval system