KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11276
Entry
Dmel_CG11276      CDS       T00030                                 

Symbol
RpS4
Name
(RefSeq) ribosomal protein S4, isoform C
  KO
K02987  small subunit ribosomal protein S4e
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dmel_CG11276 (RpS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dme03011]
    Dmel_CG11276 (RpS4)
Ribosome [BR:dme03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    Dmel_CG11276 (RpS4)
  Archaea
    Dmel_CG11276 (RpS4)
SSDB
Motif
Pfam: Ribosomal_S4e 40S_S4_C RS4NT S4 KOW DUF4224
Other DBs
NCBI-GeneID: 39484
NCBI-ProteinID: NP_001287055
FlyBase: FBgn0011284
UniProt: P41042 X2JGM9
Structure
Position
3L:13041756..13044234
AA seq 261 aa
MARGPKKHLKRLAAPKAWMLDKLGGVFAPRPSTGPHKLRESLPLLIFLRNRLKYALNGAE
VTKIVMQRLVKVDGKVRTDPTYPAGYMDVITLEKTGEFFRLVYDVKGRFVIHRISAEEAK
YKLCKVKKTQLGAKGVPFLVTHDGRTIRYPDPLIHANDSVQVDIASGKITDYIKFDSGNL
CMITGGRNLGRVGTVVNRERHPGSFDIVHIKDSQGHVFATRLTNVFIIGKGNKPYISLPK
GKGVKLSIAEERDKRLAAKTH
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctcgtggccccaagaagcatttgaagcgtttagccgcccccaaggcatggatgttg
gacaagctgggaggcgtcttcgccccgcgtccctcgaccggtccacacaagctccgtgag
tcgctgcccctgctgatcttcttgagaaaccgcttgaagtacgccctcaatggcgccgag
gtcaccaagatcgtcatgcagcgcctggttaaggtcgatggaaaggtccgcaccgacccc
acctatcccgctggctacatggatgtcatcaccctcgagaagaccggtgagttcttccgt
ctggtctacgacgtgaagggacgcttcgtcatccaccgcatctccgccgaggaggccaag
tacaagttgtgcaaggtcaagaagacccagctgggagccaagggagttcctttcctggtt
acacacgacggtcgcaccatccgctacccggatcccctgatccacgccaacgattccgtg
caggtggacattgcctctggcaagatcaccgactacattaagttcgattctggcaacctc
tgcatgatcaccggaggcaggaatttgggacgtgtcggcaccgttgtcaaccgtgagcgt
catcccggttccttcgacattgtgcacattaaggactcgcaaggtcatgtgttcgccacc
cgtttgaccaacgtgttcatcattggcaagggcaacaagccctacatctccctgcctaag
ggcaagggtgtcaagctgagcattgcggaggagcgcgacaagcgtctggccgccaagacc
cactaa

DBGET integrated database retrieval system