KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11280
Entry
Dmel_CG11280      CDS       T00030                                 

Gene name
trn
Definition
(RefSeq) tartan, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRCT LRRNT
Other DBs
NCBI-GeneID: 39491
NCBI-ProteinID: NP_001261796
FlyBase: FBgn0010452
UniProt: M9PFH7
Position
3L
AA seq 751 aa
MQRNMMIAFVGIWCILASIGVEPAAGLANCPPGCQCDDNTLVVQCGEGQLDVLPIALNPS
IQRLVIKSNKIKTIDSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHLNHNKIGQ
ISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLLKIEELNLGENRIGYLDPKAFDGLSQL
RILYLDDNALTTVPDPVIFQAMPSLAELFLGMNTLQSIQADAFQDLKGLTRLELKGASLR
NISHDSFLGLQELRILDLSDNRLDRIPSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQ
LKRLEVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANA
LTSLAEGLFPWKDLQTLDLSENPLSCDCRVMWLHNLLVAKNASQDDVSELLCEFPERLRG
ESLRHLNPAMMGCTHADPRKQALIGALLVGSAATITALALVLYRCRHKIRETIKGGLWGN
SALGRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTAPHHPGATHHYGMCPMPVN
DLGAIDPQQKFQQLVVPTATMISEKKLNNNKALVSQGAIDDSASFVLHMKSATMGRDVHQ
QNPQLNHYTKPQFLSATATVGDSCYSYADVPMVHGAPLGGPNQPQLRLTQEHFKQRELYD
QEMGSEILDHNYIYSNTHYSMPLEQLGRSKTPTPPPMPPALPLRNGLCATTGRRSFQQKS
ASQKQQQNNNTLRQFTHXSSTYRRRQLSIYA
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgcagcgaaacatgatgatcgccttcgtgggcatctggtgcattttggccagcattggt
gtggagcctgcggcgggcttggccaattgcccgcccggctgtcagtgcgatgataatacc
ctggtggtacaatgtggcgagggccagctggacgtgctgcccattgctctgaatccatcc
atccagcgactggtgattaagagcaacaagatcaagaccatcgactcgtccatccagttc
tacgcggagctgaccttcctcgatctgtcctcgaatcacctgatgaccattccgcagcgc
accttcgcctatcagaagaagctgcaggaggtgcatctgaatcacaacaagattgggcag
atcagcaataagaccttcattggtctgtcggcagttactgttctgaatctgcgtggtaac
caaatctcggaacttcaccagggcacctttactcctctcctgaagatcgaggagctgaat
ctgggcgagaatcgcatcggctatctggatcccaaggctttcgatggactctcccagttg
cgcatcctttatctggatgataatgccttgaccaccgttcccgatcccgtgatcttccaa
gccatgcccagtctggctgagctgttccttggaatgaacaccctgcagagcattcaggct
gatgccttccaggacctgaaaggacttactcgcctggaactcaagggtgccagtctacgc
aacatctcccacgacagcttcctcggcttgcaggagttgcgcattcttgatctttccgat
aatcgtctggatcgcattccctccgtgggtctcagcaagctggttcgtctggagcagctg
tccctgggtcaaaacgatttcgaggtgatcagcgaaggcgcattcatgggcctgaagcaa
cttaaacgcctggaggtgaatggagctcttaggctgaagcgtgtgatgaccggagccttc
agcgacaatggtaacctggagtatctgaatctatcgtccaacaaaatgcttttggaggtt
caagaaggtgccctcagtgggctgtcccaattgaagcatgttgttctcaaggccaatgcg
ctgacttccttggcagaaggtctgttcccgtggaaggatcttcagactctggacctttcc
gaaaatcccttgtcctgcgactgccgtgtgatgtggctgcacaatctgctggtggccaag
aatgccagtcaggatgatgtctccgaactgctgtgtgagttccccgaacgtctgcgcggt
gaatccttgcgccatttgaatcctgctatgatgggatgcacacatgccgatcctcgcaag
caggccttgattggagctctcctggtgggatctgctgccacgattaccgccttggctttg
gttctgtaccgctgccgtcataagatccgcgaaaccatcaagggcggtctgtggggtaac
tcggctctgggccgtaaggaacgggaataccagaagaccttctgcgacgaggactacatg
tcgcgccatcagcatcatccctgctccctgggcatccactccacgttccccaacacctat
accgcacctcatcatcccggagctacccatcactatggaatgtgcccgatgcctgtcaat
gacctgggcgccatcgatccccagcagaagttccaacagttggtagtgcccaccgccaca
atgatcagtgagaagaagctgaataacaacaaggccctggtttcacagggagccatcgac
gacagtgcctcatttgtgctgcacatgaagtcggccaccatgggtcgggatgtgcatcag
cagaatccccagctgaaccactataccaagccgcagttcctctcggccacggctacagtt
ggtgattcctgctactcatacgcggatgtgcccatggtgcatggcgccccgttgggtgga
ccgaatcagccgcaactgcgactgacccaagagcacttcaagcagcgtgagctatacgat
caggagatgggcagcgagatcctggaccacaactacatctacagcaatacccactactcg
atgccgttggagcaactgggtcgcagcaagacgcccacgccgccaccgatgccaccagct
ttgcccctgcggaatggactgtgtgccaccacaggacgcagatccttccagcagaagtcc
gcctctcagaagcagcagcagaacaacaacaccctgcgtcagttcacgcactgatcctcg
acctatcgacgcaggcagctgagcatctatgcttag

DBGET integrated database retrieval system