KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11335
Entry
Dmel_CG11335      CDS       T00030                                 

Gene name
Loxl1
Definition
(RefSeq) lysyl oxidase-like 1
  KO
K00277  protein-lysine 6-oxidase [EC:1.4.3.13]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dmel_CG11335 (Loxl1)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.13  protein-lysine 6-oxidase
     Dmel_CG11335 (Loxl1)
SSDB
Motif
Pfam: Lysyl_oxidase SRCR SRCR_2 Hepsin-SRCR
Other DBs
NCBI-GeneID: 43712
NCBI-ProteinID: NP_524607
FlyBase: FBgn0039848
UniProt: Q9V9X5
Position
3R
AA seq 360 aa
MASFRFQLLQLLVVLSQGWANLNVQNNYRNMMVRLATNKAALAGIQVLREGRVEVSFDFG
ASWGTICSTSWSMREANVVCRQLGLGYASKASQGTEHGDSRKYPWGMVGTLCRGTERRLA
DCIRESHYPNLCNARNHNVSIAACVSHSADLEIGLVDIERTARLEAVPMSRLTCAMEEHC
VSADAYEIRRTNPHAARILLRFSVKASNVGTADVSPYANYKEWVWHQCHRHYHSMNVFAT
FDVYDLNYRKVAQGHKASFCLMDSECRPGVRQKYTCGNTTQGISVGCADTYTDVLDCQWV
DVTRVPINRRYILRVALNPEYKLGEISFENNGAECLLDYTGVRQTTRIFNCRRKPLWFKI
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcttcgttccggtttcaattgttgcagctcctagtggttctcagccaaggttgggcc
aacctcaacgtgcagaacaactatagaaacatgatggtccgactggccactaacaaggca
gcgctcgccggtattcaagtcctccgcgagggacgcgtggaggtgagctttgactttggc
gcctcatggggtacgatctgcagcacttcgtggagcatgcgggaggcaaatgtggtgtgc
cgacagctaggattgggctacgcttccaaggcaagccagggaacggagcacggggatagc
cggaagtatccctggggcatggtgggcactctgtgcaggggaaccgagcgtcgcctagcc
gactgcatccgggagtcccactacccgaacctctgcaatgccagaaaccataatgtcagc
attgcggcctgtgttagccattcggctgacctggagatcggactggtggacatcgagaga
accgcccgcctggaggccgtgcccatgtcgcggctcacatgcgccatggaagagcactgt
gtttccgccgacgcttacgagatccgaaggacgaatccgcacgctgcgaggatactgctt
cgcttttccgttaaggcttccaatgtgggcaccgccgatgtaagcccatacgctaactac
aaggaatgggtatggcaccagtgccacagacactaccacagcatgaatgtttttgccacc
tttgatgtttacgacctcaactaccggaaggtggcccaggggcacaaggcctccttttgc
ctgatggacagtgaatgccggccaggagtacggcaaaagtacacctgtggcaacaccacc
caaggcatttccgtgggctgcgcagacacctacaccgatgtgttggactgccagtgggtg
gatgttacccgagttcccatcaaccgacgctacatcctgcgagtggccctcaatcccgag
tacaagctgggagagatatccttcgagaacaacggagctgagtgccttcttgactacact
ggcgtacggcagacgacaaggattttcaactgtcggcgaaagccgctttggtttaagatt
tga

DBGET integrated database retrieval system