KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11459
Entry
Dmel_CG11459      CDS       T00030                                 

Symbol
CG11459
Name
(RefSeq) uncharacterized protein, isoform B
  KO
K01365  cathepsin L [EC:3.4.22.15]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04140  Autophagy - animal
dme04142  Lysosome
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG11459 (CG11459)
   04142 Lysosome
    Dmel_CG11459 (CG11459)
   04140 Autophagy - animal
    Dmel_CG11459 (CG11459)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG11459 (CG11459)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG11459 (CG11459)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
    Dmel_CG11459 (CG11459)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.15  cathepsin L
     Dmel_CG11459 (CG11459)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C1: papain family
   Dmel_CG11459 (CG11459)
Chaperones and folding catalysts [BR:dme03110]
 Intramolecular chaperones
  Papain family
   Dmel_CG11459 (CG11459)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
 Others
  Dmel_CG11459 (CG11459)
SSDB
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 SENP3_5_N O-antigen_lig
Other DBs
NCBI-GeneID: 40741
NCBI-ProteinID: NP_001287191
FlyBase: FBgn0037396
UniProt: Q9VNK6
Position
3R:complement(6025826..6027238)
AA seq 336 aa
MGTPRLTVVHGLILLLLVELGLTAVSDTEWDQYKAKYNKQYRNRDKYHRALYEQRVLAVE
SHNQLYLQGKVAFKMGLNKFSDTDQRILFNYRSSIPAPLETSTNALTETVNYKRYDQITE
GIDWRQYGYISPVGDQGTECLSCWAFSTSGVLEAHMAKKYGNLVPLSPKHLVDCVPYPNN
GCSGGWVSVAFNYTRDHGIATKESYPYEPVSGECLWKSDRSAGTLSGYVTLGNYDERELA
EVVYNIGPVAVSIDHLHEEFDQYSGGVLSIPACRSKRQDLTHSVLLVGFGTHRKWGDYWI
IKNSYGTDWGESGYLKLARNANNMCGVASLPQYPTF
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgggcacgcctcgtctgaccgtagtacacggtctaatccttctgctccttgtggagcta
ggtttgactgcggtcagcgatacggagtgggaccagtacaaggctaagtacaacaagcag
tacaggaacagggacaaataccaccgggcgctatacgaacagagggtcctggcggtggaa
agccacaaccagctctatttgcagggaaaggttgcattcaagatgggactaaacaagttc
tccgacacagatcagagaatcctcttcaattatcgctcgtcgatcccagcgccgctggag
acgagtaccaatgcacttacggagactgtaaactacaagaggtacgaccagatcaccgaa
ggaatcgactggcggcagtacggctatatatcgccagtgggagaccagggcaccgagtgc
ctgagctgctgggccttctccacctcgggtgttcttgaggcacatatggcgaagaagtat
ggaaatctggttcccctttcacccaagcacttggtggactgtgttccctatccgaataac
ggctgcagcggtggttgggtgagcgtggcctttaactacaccagggaccatggcatcgcc
acaaaggaatcctatccgtacgagcctgtatcaggagaatgcctgtggaaaagcgacaga
agtgcaggcacattgtcgggctacgtcactctcggcaactacgatgaacgggaactggcg
gaggtggtctacaacattggacccgtggcggtgtccattgaccatctccacgaggaattc
gatcagtactccggtggagtcctcagtattccggcgtgcagatctaagagacaggacctt
acacactccgttcttttagtcggctttggaacccatcggaagtggggagactactggata
ataaagaactcctatggaaccgattggggagaaagtggctacttaaagctagctcggaac
gccaacaacatgtgtggagtggcatcacttccccaatatcccactttttga

DBGET integrated database retrieval system