KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11491Help
Entry
Dmel_CG11491      CDS       T00030                                 

Gene name
br
Definition
(RefSeq) broad, isoform H
  KO
K02174  broad-complex core protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG11491 (br)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG11491 (br)
Transcription factors [BR:dme03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Others
    Dmel_CG11491 (br)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-C2H2_6 zf-Di19 FYVE zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 44505
NCBI-ProteinID: NP_001138144
FlyBase: FBgn0283451
UniProt: Q24206 Q9W572
Position
X
AA seq 880 aa AA seqDB search
MDDTQHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFREL
LKSTPCKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLTQQQA
EDTHSHLAQIQNLANSGGRTPLNTHTQSLPHPHHGSLHDDGGSSTLFSRQGAGSPPPTAV
PSLPSHINNQLLKRMAMMHRSSAAAAAEETSHAFKRLRGSDNSLPLSGAVGSGSNNNSPD
LPPLHARSASPQQTPADFSTIKHHNNNNTPPLKEEKRNGPTGNGNSGNGNGNGNGASNGN
GISISDKLGSLTPSPLARAGADDVKSEPMDMVCSNNNANANDEHSNDSTGEHDANRSSSG
DGGKGSLSSGNDEEIGDGLASHHAAPQFIMSPAENKMFHAAAFNFPNIDPSALLGLNTQL
QQSGDLAVSPQGGSTGSLLSGVIVPGGSGGTPSNSSSNNNNNNSNNQQQKVEQQSSPHQL
LQQQHHSTPHTNSPQLKQEQPKSGGGSCKSSDLHIAAGSERSLSRSSQGMPDAGGHSATP
SPTAAYHKRERERERERERERERERERSLDHERDLERPGGTGSPPPPPPSHHSHFGQHPL
SLLPSHHQLHATHHELSAAAAHHAHAHAHAAHAHALARAGSPMEHHHLLHHRRASLSPSG
AVSSASGAGGRGGGAGGPGGPGGSLLSSVRAQDVAQANRLLLPLPLNACHRCDVCGKLLS
TKLTLKRHKEQQHLQPLNNAVCNLCHKVFRTLNSLNNHKSIYHRRQKNHHSYFHHGAGVS
QAGSPGSRLHQSLSSLSAAAAAANNSVNVGGGSVGGAGGNAVAAAAAAAAAAAELLLSPI
VGAAAVAGGTASSTLQLAAAHQQQQQQSSPGIVKPCMDFL
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atggacgacacacagcacttctgcctgcgctggaacaactaccagagcagcataacctcg
gcgttcgagaatctgcgcgacgacgaggccttcgtggatgtgaccctcgcctgcgaggga
cgcagcatcaaggcacaccgcgtcgtcctctccgcctgcagtccctacttccgcgagctg
ctcaagagcacaccctgcaaacacccggtcatactgctgcaggatgtcaacttcatggac
ctgcacgccctggtggagttcatctaccacggcgaggtcaacgtgcaccagaagtccctg
cagtccttccttaagaccgccgaagtgctgcgcgtctctggactcacgcagcagcaggca
gaggacacacacagccatctggctcagatacagaacctggccaattccggcggccgcacg
ccgctcaacacgcacacccaatcgctcccacatccgcaccatggctcgctacacgacgac
ggcggctcctcgaccctcttcagccgccagggagcgggttcgccaccgccgacggcggtg
ccatcgctgccctcgcacatcaacaaccagctgctgaagcgcatggccatgatgcaccgc
agcagtgccgccgccgccgccgaggagacctcccacgcctttaagcgtctgcgcggctcg
gacaacagcctgccgctgtccggcgccgttggcagtggcagcaacaacaacagccccgac
ttgccgccgcttcatgcgcgcagcgcctcgccccagcagactccggccgacttcagtacg
atcaagcaccacaacaacaacaacacgccgccgctgaaggaggagaagcgcaacggaccc
acaggcaacggaaactctggcaacggcaatggcaatggcaacggagcgagcaacggcaac
ggaatctccatcagcgacaagctgggcagcctcacaccttcgccgctggctcgagcgggc
gccgatgatgtcaagtcggagcccatggacatggtctgctctaacaacaatgccaatgcc
aacgacgaacacagcaacgactccaccggcgagcacgatgccaatcgctccagtagcggc
gacggcggcaagggatccctgagctccggcaacgacgaggagatcggcgacggactcgcc
tcccatcatgccgcccctcagttcatcatgtcgccggcggagaacaagatgttccatgca
gccgccttcaactttcccaatatcgatccctcagcgttgctaggtctcaacacacagttg
cagcagtccggtgacctcgccgtgtcccctcaaggtggcagcaccggcagcctactcagt
ggcgtcattgtgcccggcggtagtggtggcacccctagtaatagtagtagcaacaacaac
aacaacaacagcaacaatcaacaacaaaaagtagaacaacagtcatcaccacaccaactc
ctccaacaacaacatcattccacaccacataccaacagtccacaactgaagcaggaacaa
ccgaaatcgggcggcgggagctgcaagtccagcgacctgcacattgcagcgggtagtgag
cgcagcctctcccgatcctcccaaggaatgccagacgccggcgggcacagtgccacgccc
tcgcccaccgccgcctaccacaagcgcgagagggagcgcgaaagagaacgcgaacgggag
cgggagcgcgagcgggaacgctcgctcgaccatgagcgcgacttggagaggccaggcggc
accggctcaccaccaccgccgccgccgtcgcaccactcacatttcggccagcacccattg
tcgctgttgcccagccaccaccagctgcacgcgacccaccacgagctgagcgccgctgcc
gcccaccacgctcacgcccatgctcatgccgcccacgcccatgccttggcacgcgccgga
tcgcccatggagcaccatcacctgttgcaccacagacgcgcctcgctctccccctcgggg
gccgtttcctcggccagcggagcgggtggacgcggaggcggcgctggcggaccgggagga
cccggcggcagcctgctgtcatcagtgcgcgcccaggacgtggcccaggccaatagactc
ctcctgcccctgcccctcaacgcctgccaccggtgcgacgtgtgcggcaaactgttgagc
accaagctcacgctgaaacgccacaaggagcagcagcacctgcagccgctgaacaacgcc
gtttgcaacctgtgccacaaggtcttccgcacgctgaactcgctgaacaaccacaagagc
atctatcatcgccgccagaagaaccaccactcgtatttccaccacggcgccggggttagc
caagcgggcagtccgggcagtcggctgcatcagtcgctcagttcgttgagcgcagcagca
gcggcggccaacaatagcgttaatgtgggcggtggatcggtaggcggggccgggggcaat
gcagtggctgctgctgcagccgcagctgccgcggcggccgaactgcttctctctccgatc
gttggcgccgctgccgtggccgggggtacggccagctccacgctccagctggcggcggcg
caccagcagcagcagcaacagtcgtcgccgggcattgtcaaaccgtgcatggacttctta
taa

DBGET integrated database retrieval system