KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11579
Entry
Dmel_CG11579      CDS       T00030                                 
Symbol
arm
Name
(RefSeq) armadillo, isoform F
  KO
K02105  catenin beta 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG11579 (arm)
SSDB
Motif
Pfam: Arm HEAT_2 Adaptin_N Cnd1 HEAT KAP ARMC9_ARM V-ATPase_H_N Atx10homo_assoc Arm_2 HEAT_EZ Proteasom_PSMB RIX1
Other DBs
NCBI-GeneID: 31151
NCBI-ProteinID: NP_001259149
FlyBase: FBgn0000117
UniProt: P18824 M9PGG4
Position
X:complement(1891401..1900646)
AA seq 843 aa
MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGK
EDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPST
QFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAA
MMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIF
KSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVK
FLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSS
NKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST
DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLT
SRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGA
IHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNR
ALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSR
NEGVATYAAAVLFRMSEDKPQDYKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGP
EEAYEGLYGQGPPSVHSSHGGRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGA
VGGASGGGGNIGAIPPSGAPTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYD
TDC
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagttacatgccagcccagaatcgaaccatgtcgcataataatcaatacaatccacct
gatctgccgccgatggtatccgccaaggagcagaccctcatgtggcagcagaattcgtac
ttgggcgactccggcatccactcgggtgccgtgacccaggttccatcgctgtctggcaag
gaggacgaggagatggagggagatccacttatgttcgacctggacaccggtttcccgcag
aatttcacacaagaccaagtggacgatatgaaccagcaactgagccagacacgctcccaa
cgtgtacgtgctgccatgtttccggaaaccctggaggagggcattgagattccctccacc
cagtttgatccccaacagccgacggcagtgcaacgtctttcggaaccgtcacaaatgcta
aagcacgcggtggtcaatctgatcaactaccaggacgacgctgagctggcaaccagggcc
atacccgagttgatcaagctgctgaacgatgaggatcaggtggtagtttcccaggccgcc
atgatggtccaccagctgtctaagaaggaggcctcgcgacatgccattatgaacagccct
cagatggtagccgctttggtgcgtgccatctctaacagcaacgatctggagagcaccaag
gcagcggtaggaacactgcacaacttatcacaccatcgccagggtctgctggccatcttc
aagagtggcggcatcccggcactcgtcaagttgctctcctcgccagtggagagtgtgctg
ttctatgcaattaccactctgcacaatttgctgctccaccaggatggctctaagatggct
gtgcgcctggccggcgggcttcagaagatggttactctgctgcaacgaaacaacgttaag
tttctggctatcgtcacagattgcttgcaaattctggcctatggtaaccaggagagcaag
ttaataattcttgcctccggagggcccaacgaactcgtgcgcattatgcgctcctacgac
tacgagaagcttctgtggaccacttcgcgggtactgaaagtgctctccgtttgctccagc
aacaagccggccatcgtggatgccggtggaatgcaggcgctggctatgcacttgggtaac
atgtcaccgcgccttgtgcaaaactgtttgtggacgctccgcaatctttcggatgcagcc
actaaggtggagggccttgaagctttgctccaatctctcgtccaggttctgggctcgacc
gatgtcaacgtggtcacctgtgccgccggtatcctttcaaatctgacgtgcaacaatcag
cgcaacaaggccaccgtttgtcaggtgggcggtgtggacgccctcgtccgtactattatc
aatgctggagatcgcgaagagattaccgagccggctgtatgtgccctgcgtcacttgacc
tcgcgtcatgtggactctgagttggcccagaatgccgtacgcttaaactacggactatcg
gtgattgtaaagctattgcatccaccatcacgctggcccttgatcaaggccgtcattgga
ctcatacgcaatttggccctctgtccggccaatcacgccccgttgcgggagcacggggcc
atccaccatctggtgcgactgcttatgcgcgccttccaagacacagagaggcaacgttcc
tcgatagccaccactggttcacagcagccgtccgcatacgctgacggcgttcgcatggag
gagattgtcgagggcacggtgggggcgctacatatcctggcccgcgagtctcacaaccgg
gcactcattcgccagcagtcggtaataccgatctttgtacgattgctgttcaacgaaatc
gagaacatacagcgcgtggctgctggcgttctttgtgagctcgccgctgacaaggagggc
gccgagattatcgagcaggagggcgccactgggccgctgaccgatctcctgcactcgcgc
aatgaaggcgtggccacatacgccgccgctgttctctttcgcatgagtgaggacaagccg
caggattacaagaagcggctatccatagagctgaccaactcgctgctgcgcgaggacaac
aacatatgggccaatgccgacctgggcatgggtcccgatctacaggatatgcttggacca
gaagaagcatatgagggcctgtacggacaaggtccgcccagcgtgcacagttcacacgga
ggtcgcgcattccatcagcaaggatatgatactctaccaatagattcgatgcagggtctg
gagatcagcagcccagtgggcggcggcggtgctggcggtgctcccggcaatggtggagct
gtaggcggagctagcggcggcggtggtaacatcggcgccattccgcctagcggcgcacca
acttcgccctattccatggacatggacgttggcgagattgatgccggtgcattgaacttt
gacttggacgccatgccgacgccacccaatgacaacaacaacctggctgcctggtacgat
accgattgttag

DBGET integrated database retrieval system