KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11579Help
Entry
Dmel_CG11579      CDS       T00030                                 

Gene name
arm
Definition
(RefSeq) armadillo, isoform F
  KO
K02105  catenin beta 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG11579 (arm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Adaptin_N HEAT_2 Cnd1 KAP Arm_2 Atx10homo_assoc PUL
Motif
Other DBs
NCBI-GeneID: 31151
NCBI-ProteinID: NP_001259149
FlyBase: FBgn0000117
UniProt: P18824 M9PGG4
Position
X
AA seq 843 aa AA seqDB search
MSYMPAQNRTMSHNNQYNPPDLPPMVSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGK
EDEEMEGDPLMFDLDTGFPQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPST
QFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDAELATRAIPELIKLLNDEDQVVVSQAA
MMVHQLSKKEASRHAIMNSPQMVAALVRAISNSNDLESTKAAVGTLHNLSHHRQGLLAIF
KSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVTLLQRNNVK
FLAIVTDCLQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRVLKVLSVCSS
NKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSLVQVLGST
DVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRHLT
SRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGA
IHHLVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNR
ALIRQQSVIPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSR
NEGVATYAAAVLFRMSEDKPQDYKKRLSIELTNSLLREDNNIWANADLGMGPDLQDMLGP
EEAYEGLYGQGPPSVHSSHGGRAFHQQGYDTLPIDSMQGLEISSPVGGGGAGGAPGNGGA
VGGASGGGGNIGAIPPSGAPTSPYSMDMDVGEIDAGALNFDLDAMPTPPNDNNNLAAWYD
TDC
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgagttacatgccagcccagaatcgaaccatgtcgcataataatcaatacaatccacct
gatctgccgccgatggtatccgccaaggagcagaccctcatgtggcagcagaattcgtac
ttgggcgactccggcatccactcgggtgccgtgacccaggttccatcgctgtctggcaag
gaggacgaggagatggagggagatccacttatgttcgacctggacaccggtttcccgcag
aatttcacacaagaccaagtggacgatatgaaccagcaactgagccagacacgctcccaa
cgtgtacgtgctgccatgtttccggaaaccctggaggagggcattgagattccctccacc
cagtttgatccccaacagccgacggcagtgcaacgtctttcggaaccgtcacaaatgcta
aagcacgcggtggtcaatctgatcaactaccaggacgacgctgagctggcaaccagggcc
atacccgagttgatcaagctgctgaacgatgaggatcaggtggtagtttcccaggccgcc
atgatggtccaccagctgtctaagaaggaggcctcgcgacatgccattatgaacagccct
cagatggtagccgctttggtgcgtgccatctctaacagcaacgatctggagagcaccaag
gcagcggtaggaacactgcacaacttatcacaccatcgccagggtctgctggccatcttc
aagagtggcggcatcccggcactcgtcaagttgctctcctcgccagtggagagtgtgctg
ttctatgcaattaccactctgcacaatttgctgctccaccaggatggctctaagatggct
gtgcgcctggccggcgggcttcagaagatggttactctgctgcaacgaaacaacgttaag
tttctggctatcgtcacagattgcttgcaaattctggcctatggtaaccaggagagcaag
ttaataattcttgcctccggagggcccaacgaactcgtgcgcattatgcgctcctacgac
tacgagaagcttctgtggaccacttcgcgggtactgaaagtgctctccgtttgctccagc
aacaagccggccatcgtggatgccggtggaatgcaggcgctggctatgcacttgggtaac
atgtcaccgcgccttgtgcaaaactgtttgtggacgctccgcaatctttcggatgcagcc
actaaggtggagggccttgaagctttgctccaatctctcgtccaggttctgggctcgacc
gatgtcaacgtggtcacctgtgccgccggtatcctttcaaatctgacgtgcaacaatcag
cgcaacaaggccaccgtttgtcaggtgggcggtgtggacgccctcgtccgtactattatc
aatgctggagatcgcgaagagattaccgagccggctgtatgtgccctgcgtcacttgacc
tcgcgtcatgtggactctgagttggcccagaatgccgtacgcttaaactacggactatcg
gtgattgtaaagctattgcatccaccatcacgctggcccttgatcaaggccgtcattgga
ctcatacgcaatttggccctctgtccggccaatcacgccccgttgcgggagcacggggcc
atccaccatctggtgcgactgcttatgcgcgccttccaagacacagagaggcaacgttcc
tcgatagccaccactggttcacagcagccgtccgcatacgctgacggcgttcgcatggag
gagattgtcgagggcacggtgggggcgctacatatcctggcccgcgagtctcacaaccgg
gcactcattcgccagcagtcggtaataccgatctttgtacgattgctgttcaacgaaatc
gagaacatacagcgcgtggctgctggcgttctttgtgagctcgccgctgacaaggagggc
gccgagattatcgagcaggagggcgccactgggccgctgaccgatctcctgcactcgcgc
aatgaaggcgtggccacatacgccgccgctgttctctttcgcatgagtgaggacaagccg
caggattacaagaagcggctatccatagagctgaccaactcgctgctgcgcgaggacaac
aacatatgggccaatgccgacctgggcatgggtcccgatctacaggatatgcttggacca
gaagaagcatatgagggcctgtacggacaaggtccgcccagcgtgcacagttcacacgga
ggtcgcgcattccatcagcaaggatatgatactctaccaatagattcgatgcagggtctg
gagatcagcagcccagtgggcggcggcggtgctggcggtgctcccggcaatggtggagct
gtaggcggagctagcggcggcggtggtaacatcggcgccattccgcctagcggcgcacca
acttcgccctattccatggacatggacgttggcgagattgatgccggtgcattgaacttt
gacttggacgccatgccgacgccacccaatgacaacaacaacctggctgcctggtacgat
accgattgttag

DBGET integrated database retrieval system