KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11624Help
Entry
Dmel_CG11624      CDS       T00030                                 

Gene name
Ubi-p63E
Definition
(RefSeq) Ubiquitin-63E, isoform D
  KO
K08770  ubiquitin C
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG11624 (Ubi-p63E)
Ubiquitin system [BR:dme04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   Dmel_CG11624 (Ubi-p63E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Ubiquitin_5 Rad60-SLD_2
Motif
Other DBs
NCBI-GeneID: 38456
NCBI-ProteinID: NP_001261383
FlyBase: FBgn0003943
UniProt: P0CG69 A4V1F9
Position
3L
AA seq 763 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIQA
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcagatctttgtgaagactttgaccggaaagaccatcaccctcgaggtagagccctcg
gacaccattgagaatgttaaggctaagatccaagacaaggaaggaattcccccagatcag
cagcgtctgatcttcgccggcaagcaactggaagacggacgcaccctgtccgattacaac
attcagaaggagtccacccttcacttggtccttcgtctccgtggtggtatgcagatcttc
gtgaagactttgaccggaaagaccatcaccctcgaggtagagccatcggacaccattgag
aatgtgaaggccaagattcaggataaggagggaatccccccagatcagcagcgtctgatc
ttcgctggcaagcagcttgaggatggacgcaccctgtccgattacaacatccagaaggag
tccacccttcacttggtccttcgtctccgtggtggtatgcagatcttcgtgaagactttg
accggaaagaccatcaccctcgaggtagagccatcggacacaattgagaatgttaaggct
aagatccaagacaaggagggaattcccccagatcagcagcgtctgatcttcgccggcaag
cagcttgaggatggacgcaccctgtccgattacaacatccagaaggagtccacccttcac
ttggtccttcgtctccgtggtggtatgcagatcttcgtgaagactttgaccggaaagacc
atcaccctcgaggtagagccttcggacaccattgagaatgttaaggctaagatccaagac
aaggagggaattcccccagatcagcagcgtctgatcttcgctggcaagcagcttgaggat
ggacgcaccctgtccgattacaacattcagaaggagtccacccttcacttggtccttcgt
cttcgtggtggtatgcagatcttcgtgaagactttgaccggaaagaccatcaccctcgag
gtagagccatcggacacaattgagaatgttaaggctaagatccaagacaaggagggaatt
cccccagatcagcagcgtctgatcttcgccggcaagcagcttgaggatggacgcaccctg
tccgattacaacatccagaaggagtccacccttcacttggtccttcgtctccgtggtggt
atgcagatcttcgtgaagactttgaccggaaagaccatcaccctcgaggtagagccatcg
gacaccattgagaatgtgaaggccaagattcaggataaggagggaatccccccagatcag
cagcgtctgatcttcgccggcaagcagcttgaggatggacgcaccctgtccgattacaac
atccagaaggagtccacccttcacttggtccttcgtctccgtggtggtatgcagatcttc
gtgaagactttgaccggaaagaccatcaccctcgaggtagagccttcggacaccattgag
aatgttaaggctaagatccaagacaaggagggaattcccccagatcagcagcgtctgatc
ttcgccggcaagcagcttgaggatggacgcaccctgtccgattacaacatccagaaggag
tccacccttcacttggtccttcgtcttcgtggtggtatgcagatcttcgtgaagactttg
accggaaagaccatcaccctcgaggtagagccatcggacacaattgagaatgttaaggct
aagatccaagacaaggagggaattcccccagatcagcagcgtctgatcttcgccggcaag
cagcttgaggatggacgcaccctgtccgattacaacatccagaaggagtccacccttcac
ttggtccttcgtctccgtggtggtatgcagatcttcgtgaagactttgaccggaaagacc
atcaccctcgaggtagagccttcggacaccattgagaatgttaaggctaagatccaagac
aaggagggaattcccccagatcagcagcgtctgatcttcgccggcaagcagcttgaggat
ggacgcaccctgtccgattacaacatccagaaggagtccacccttcacttggtccttcgt
ctccgtggtggtatgcagatcttcgtgaagactttgaccggaaagaccatcaccctcgag
gtagagccctcggacaccattgagaatgttaaggctaagatccaagacaaggagggaatt
cccccagatcagcagcgtctgatcttcgccggcaagcagcttgaggatggacgcaccctg
tccgattacaacatccagaaggaatcgacccttcacttggtgctccgtctccgtggagga
atccaggcttaa

DBGET integrated database retrieval system