KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11628
Entry
Dmel_CG11628      CDS       T00030                                 

Gene name
step
Definition
(RefSeq) steppke, isoform C
  KO
K18441  cytohesin
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dmel_CG11628 (step)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG11628 (step)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dme04990]
    Dmel_CG11628 (step)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    Dmel_CG11628 (step)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    Dmel_CG11628 (step)
Domain-containing proteins not elsewhere classified [BR:dme04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   Dmel_CG11628 (step)
SSDB
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3
Other DBs
NCBI-GeneID: 35425
NCBI-ProteinID: NP_001036375
FlyBase: FBgn0086779
UniProt: Q0E8N2
Position
2L
AA seq 727 aa
MASLHQKRPSISNWFSSLRRQPKNKKCSPGLGGSESVGRKQPLQRSCLDLSTTRVGCDGC
VSLEFFQSESPESRRSNSTFYVNTQNVSSAVFKDNRQPLLERGSGSDSSPSSVCVRCSCN
SITKSGDRNETPTMATPKSDIKIALKPPPKPRSPSMAPYTSVATYNITKLAPDSPPPASP
TLSTQTVNCSDVTTKVTEVQRLPCDEPNTELISKRTEYKHTTITTTTRTLIVSRPVELLL
NENGEIIARRSPRKSRSNSLGRMLDVQNEIGTGGLFMEADPCSKNSLPPPPYIDDMRFID
DSSNSQSESERNSNIHKTNKYTSKNNNNDSKRESQQSNLCESCRMLLDRNYINTEQSDNL
VILRRPSKQIKDELCEVVSEMEALDVPEDCKHSNKDKQMSIGRKKFNMDPKKGIEYLVEN
RLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKNDFNEDVLKAFVALHDFTNLILVQALRQ
FLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKD
KPTVDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWL
WKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFA
TGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSISHNPFYDILVQRK
KKALSKS
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggcatccctccatcagaagcgtcccagcataagtaactggttctcctcgcttcgtcgg
cagcccaaaaacaagaagtgctcccccggcttgggaggaagtgaaagtgttggcagaaag
cagccattgcagaggagctgccttgacctatccacgacgcgagttggttgcgatggttgt
gtaagtttggagttctttcaatcggaatcccctgaaagtcggcgaagcaacagcactttc
tatgtcaacacccaaaatgtatcgtctgctgtttttaaagacaatcgtcagcctctattg
gaaaggggcagcggtagtgatagtagccctagcagcgtttgcgttcgatgctcatgcaat
tcgataacgaaaagcggggacagaaatgaaacacctacaatggccacgcctaagtcggac
attaagatcgcgctgaaacctccacccaagccccgctccccttccatggctccctacact
agtgtggctacatataacatcacgaaattagcgccggacagcccaccccccgccagcccc
acattaagcactcaaaccgtaaattgcagcgatgtaaccacgaaggtcacagaggtacag
cgcctaccctgcgatgaacccaacactgaactcataagcaagcgaacggagtacaagcac
acaaccatcacaacaacgacaagaacattaattgtgtcgcgacccgtggaactgctttta
aatgaaaatggcgaaataatcgcaaggcgatccccccgcaaatcgcgctctaattccctg
ggccgcatgcttgacgtgcagaatgaaattggaactggcgggttgtttatggaagcggat
ccttgttcgaaaaacagtttaccgcctccaccctatatcgacgatatgcgcttcattgat
gacagctccaactcacaaagtgagtccgagcggaactctaacatacacaaaaccaacaaa
tatacttcaaagaataataacaacgacagcaagcgggagagccagcaatcgaatctgtgc
gagagttgccgcatgcttctcgatcgaaattacataaatactgaacagagtgacaatcta
gtcatcctcaggcgaccatcaaagcaaattaaagatgagttgtgcgaggttgtatcggaa
atggaggcgctggatgtgcccgaagactgcaagcattccaataaagataaacagatgtcc
attggccgtaaaaagtttaacatggacccaaaaaaaggcattgagtatctcgttgaaaac
aggctgctacgtcatgatccccaggacgttgcccactttctctataagggagagggacta
aataaaacagccattggcgattacctcggcgagaaaaacgattttaatgaggatgtgctt
aaggcttttgtggcgcttcacgatttcaccaatctcattctcgtacaagccctcagacaa
tttctgtggtcgtttcgcctgcccggcgaggcacaaaagatcgatcgcatgatggagacc
ttcgcacagcgctactgtcaactaaatccagatatattcaccaacacggacacatgctat
gtgctcagcttcgcaattataatgctaaatacctcactacacaatccatctgttaaagac
aaacccaccgttgatcaattcatatcgatgaatcgtggcatcaacaacggcggagatttg
ccccgtggcctgctggaatccctttacgagtcaattcgaacagagccatttaaaatacca
caggatgatggaaatgatttgatgcacaccttcttcaatcccgacaaggagggctggctg
tggaagcaaggcggcagatacaaatcgtggaaacgacgttggttcattttgaacgataat
tgcttatactattttgaatacacaacggataaggaaccacgcggaattataccgctggag
aatatatcggtgcgcgagattcacgatcgcagcaaaccgcattgctttgagttgtttgcg
acgggcggtgctgatataatcaaggcatgcaagactgactctgagggcaaagtggtagag
ggcaagcatacggtgtaccgcatgtccgctgccacggaggaagatcagcaggagtggatc
aagcgtttgacgcagtccataagccataatccgttttatgacatcctggtacaaagaaag
aaaaaggcactcagcaagagttaa

DBGET integrated database retrieval system