KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11703
Entry
Dmel_CG11703      CDS       T00030                                 

Gene name
CG11703
Definition
(RefSeq) uncharacterized protein
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 42307
NCBI-ProteinID: NP_650792
FlyBase: FBgn0038690
UniProt: Q9V3Q7
Position
3R
AA seq 353 aa
MPEDVMVPAGDYKLVKQIRRNQETRRKKDLPWSKRIFDIDEHKLFGRTALGWMRITGFYL
VLYALIVCIVAFWLGIFMLAIIDPNKPRWLKGPPGLSMVPNQNRSVLAYFTHIMSEVNPI
ADRIDDFLNKLNDNAIDFFADFNQDTTWGYATEKPTVFIKLNKVIGYVPETYDTPDDLPK
EAPASLQDTVGKLGNTPKIWITCEVTNGPKPEMVFYPGPYFEASENMRGVTRVVAIQMNK
MPENAKTFFSCKVWARNIPIDDDYQGMGIIKFALSMRTDDDGNPDFERPSTRKAPREIDL
ESEELVPEPPSPNRPESMLGGLELPPPPEDEKDALDAMGNDAKKEEMTEPPSL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgccggaggacgtaatggtgcccgctggggactacaagctggtcaagcagatacgccgg
aaccaggagacacgtcgcaagaaggacctgccgtggtcgaagaggatattcgacatagac
gagcacaaattgttcggacgcacagctctgggttggatgcgtatcactggcttctacctg
gtactatacgccctaatcgtgtgcattgtggccttttggttgggcatctttatgctggcc
atcattgatccgaataagccgcgctggctcaagggtccgccgggtctgtcgatggtgccc
aaccagaatcgatccgtgctggcctactttacgcacatcatgagtgaggtcaatccgatt
gcggaccgcatcgacgatttcctgaacaaattgaacgacaatgccattgacttcttcgcc
gatttcaaccaggacactacgtggggctacgccaccgaaaagccgaccgtcttcatcaag
ctgaacaaggttattggctatgtgccggagacctacgacacgccagatgacttgcccaag
gaggcgccagcgagccttcaggacaccgtgggcaagctgggcaacacgcccaagatttgg
atcacctgcgaggtgaccaatgggcccaagcccgaaatggtcttctatccgggtccatat
ttcgaggcctccgagaacatgagaggagtgacgcgcgtggtggccatccagatgaacaag
atgcccgagaatgcgaagaccttcttcagctgcaaggtgtgggcccgaaacatacccatc
gacgatgactaccagggcatgggaattatcaagttcgcgctgagcatgcgcaccgatgat
gacggcaatccggatttcgaaaggccctccactcgtaaggcaccccgcgaaatagatctc
gaatccgaagagctcgttcccgaaccgccatctccaaatcgaccagaaagtatgctcgga
ggattagaattgccgccaccgccagaggatgagaaggacgcactagacgcaatgggaaat
gatgccaagaaggaggaaatgacggagccaccaagcttataa

DBGET integrated database retrieval system