KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11793Help
Entry
Dmel_CG11793      CDS       T00030                                 

Gene name
Sod1
Definition
(RefSeq) superoxide dismutase 1, isoform A
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
dme04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG11793 (Sod1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG11793 (Sod1)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dmel_CG11793 (Sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 39251
NCBI-ProteinID: NP_476735
FlyBase: FBgn0003462
UniProt: P61851
Position
3L
AA seq 153 aa AA seqDB search
MVVKAVCVINGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSG
PHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHA
DADDLGQGGHELSKSTGNAGARIGCGVIGIAKV
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggtggttaaagctgtctgcgtaattaacggcgatgccaagggcacggttttcttcgaa
caggagagcagcggtacgcccgtgaaggtctccggtgaggtgtgcggcctggccaagggt
ctgcacggattccacgtgcacgagttcggtgacaacaccaatggctgcatgtcgtccgga
ccgcacttcaatccgtatggcaaggagcatggcgctcccgtcgacgagaatcgtcacctg
ggcgatctgggcaacattgaggccaccggcgactgccccaccaaggtcaacatcaccgac
tccaagattacgctcttcggcgccgacagcatcatcggacgcaccgttgtcgtgcacgcc
gatgccgatgatcttggccagggtggacacgagctgagcaagtcaacgggcaacgctggt
gcccgcatcgggtgcggcgttattggcattgccaaggtctaa

DBGET integrated database retrieval system