KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11909
Entry
Dmel_CG11909      CDS       T00030                                 
Symbol
tobi
Name
(RefSeq) target of brain insulin
  KO
K24727  myogenesis-regulating glycosidase [EC:3.2.1.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dmel_CG11909 (tobi)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.-
     Dmel_CG11909 (tobi)
SSDB
Motif
Pfam: Glyco_hydro_31 Melibiase Bys1
Other DBs
NCBI-GeneID: 43072
NCBI-ProteinID: NP_651391
FlyBase: FBgn0261575
UniProt: Q9VBR6
Position
3R
AA seq 657 aa
MRFILLSLLLASFCLWEAVHTCASIEQRYKFPNSNVYVRLRRGDKLQYELMKGEKSLQTV
TFDNFDSSANLVETSSGSYQLTDGQSTVEFTLVKSGVVAGTGSEITHVKVSRDQVLQGTQ
PRDCVPLKTGSTHWFSGPEQKQHYWPVERQRHSNYSYLPKELDNFGVGERYWLNGDGVFL
YVESNTPLFIDQNSAAYPDQLCLSAISALPYDPRVTSAKFVYHVAVAKDAKAAHRYAVKT
FLGQPTGYPDERMVMHPVWSTWALYKAEVSDDVVRDFAKQILDNGFNNSQLEIDDDWEDC
YGAMTFRKNKFPDSKTLTDDLKALGFRVTLWIHPFINNNCTAIYDEAKSKGYLVLDHEGS
SDTQWWNSKPKDAAILDFTKTEVQEWFSKRLKRLQDEDGIDSFKFDAGETSWLPSDPVLQ
ASSSMVTPLQAVGDYVRTVAAFGDMVEVRSAQNTQDQPIFVRIVDKDSEWGWNNGLLTLI
SSMLQMNLNGYPFVLPDMIGGNGYYEKPPTKELFLRWLQANVFMPALQFSFVPWNFDDEA
IAISKNFTALHATYTPYIMKLFKRAVDSGEPVNVPLWWIAPTDEVAQSIYDEFLLGEDII
AAPVVVEGATKRDIYLPEGEWQDGNSDQVYTGPTWVMDYAAPLDTLPYFLRVGFTLE
NT seq 1974 nt   +upstreamnt  +downstreamnt
atgaggtttattttactatccctgctgttggcatccttctgcctctgggaggcggttcac
acttgtgccagcatcgagcagcgctacaagtttcccaatagcaatgtctacgtgcgactt
aggagaggtgataagttgcagtatgagctaatgaagggcgagaagtccctgcagacggtg
accttcgacaactttgacagcagcgccaatctggtggagacgagcagtggtagctaccag
cttaccgatggccaatccaccgtggagttcaccctggtcaaaagcggagtggttgccggc
acaggcagtgagataacccatgtgaaagtatcccgagatcaggtgctgcaaggcacccaa
cccagggattgcgtccccctgaagaccggatcgacgcactggttcagtggtccggagcag
aagcaacactactggccagtggagcgacagaggcatagtaactattcctacctgccaaag
gagctggataactttggtgtgggtgagcgatattggttgaacggcgacggagtctttttg
tacgtggagagcaacactcctctgtttattgatcagaatagtgctgcctatcctgaccag
ctgtgtctgagtgctattagtgctctaccctatgatcctcgggtgacctctgccaaattc
gtttaccacgtagctgtggccaaggatgccaaggcggcgcaccggtatgccgttaaaacg
ttcctcggccaacccacaggctatcccgatgagcgaatggtcatgcatcctgtgtggtcc
acatgggctctctacaaggctgaggtatccgacgatgtggttcgtgacttcgccaagcag
attctggataatgggttcaacaacagccagctggaaatcgacgatgattgggaggattgc
tatggagccatgaccttcaggaagaacaagttccccgatagcaagaccctgactgatgac
ctcaaggccttgggtttccgtgtgaccctgtggattcatccattcattaacaacaactgc
acagccatttacgatgaagctaagtctaagggttacctggtgctcgatcacgagggaagc
tccgacacgcaatggtggaacagcaagcccaaggatgcagccattttggactttaccaaa
actgaggttcaggagtggttcagcaagcgtttaaagcgccttcaggatgaggatggcatt
gatagcttcaagtttgatgccggagagaccagttggctacccagtgatcctgtactccag
gctagcagttccatggtgacaccactgcaggcggtgggcgactacgtgcgtactgtagcg
gcattcggagacatggtggaggttcgatcagcccagaacactcaagatcagccaatcttc
gtgcgcatcgtggacaaggactccgaatggggatggaacaacggcctgctcacactgatc
tcttcgatgctgcaaatgaacctcaacggttatcctttcgtccttcccgatatgattggt
ggtaatggctactacgaaaagccaccaaccaaggagcttttcctccgttggctgcaggcc
aacgtctttatgcccgccctgcagttctccttcgttccctggaactttgacgacgaggcc
attgcgatcagcaagaacttcaccgccctccatgccacctatacaccttacattatgaag
ctctttaagcgcgctgtggattctggtgaacctgtgaatgttcccctctggtggatcgcc
ccgactgatgaggtggcgcagtctatctatgatgagttccttttgggcgaagacatcatc
gctgctcccgttgtggtcgagggcgccaccaagcgagacatttacctgccagagggcgag
tggcaggatggaaacagcgaccaggtgtacactggacccacctgggtgatggactacgcc
gctcccttggataccctaccctactttttgcgcgtgggattcacactggagtag

DBGET integrated database retrieval system