KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11958
Entry
Dmel_CG11958      CDS       T00030                                 

Symbol
Cnx99A
Name
(RefSeq) calnexin 99A, isoform E
  KO
K08054  calnexin
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04141  Protein processing in endoplasmic reticulum
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG11958 (Cnx99A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG11958 (Cnx99A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG11958 (Cnx99A)
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG11958 (Cnx99A)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:dme04091]
    Dmel_CG11958 (Cnx99A)
Chaperones and folding catalysts [BR:dme03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   Dmel_CG11958 (Cnx99A)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    Dmel_CG11958 (Cnx99A)
Lectins [BR:dme04091]
 Calnexin / calreticulin
  Dmel_CG11958 (Cnx99A)
SSDB
Motif
Pfam: Calreticulin DUF4381 SpoIIIAH Connexin
Other DBs
NCBI-GeneID: 44643
NCBI-ProteinID: NP_001036766
FlyBase: FBgn0015622
UniProt: Q0KHZ9
Position
3R:complement(29315254..29319644)
AA seq 604 aa
MAWKMGGNRAATLALLFASSLLLLSAANAADLDTESDDFEDGYVEDVQEEPAVIGGDEKL
AYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWA
NDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDT
EQLKAFNDKTPYTIMFGPDKCGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDK
LPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKI
PDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAP
LVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKP
FQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDIKRRYIDRESKTFWHRL
MRRMNYKPGWWALYFVYLLIPASCYVFYLYRRAKEDSAAKKAAAEAKKSDDPQPDDEPEA
EEESDERAAGDTSKESTPLSASPKKNQKSDLDDNEEESKAAESREPAQTEESNTKTRKRQ
ARKE
NT seq 1815 nt   +upstreamnt  +downstreamnt
atggcgtggaaaatgggaggaaaccgggccgcaacgctggcgttgctcttcgccagcagt
ttgctgctgctgagtgcggccaatgccgccgatttggacacggagtcggacgacttcgag
gatggttatgtggaggatgtgcaggaggagcccgccgtcatcggtggcgatgagaagctg
gcctacgagagcccggttatcgatgccaagaagttccacttcgcggatcacttcgacgac
gtggaggagtccaggaagaggtgggtgctgtcgcaggccaagaaggacgacatcgccgag
gagatctccaagtacgacggcatctggaactgggagtcgccgcagcgcatcgtttgggct
aacgacttgggtctggtgctcaagtcgaaggccaaacacgcggccatagccgcccccctc
cgcaaaccgttcgagttcaagtcggacaagccgctggtggtgcagtacgaggtcacgttg
caggagggtcaggagtgcggtggctcgtatctgaagcttttgtccgccggaaaagacacg
gagcaactaaaagcgttcaatgacaagacaccctataccatcatgtttggaccggacaag
tgcggcaacgatgtgaaaatgcacttcatattccggcacgtcaatccaattaatggcacc
atcaccgagaagcactgcaacaagccaaagaaccgtttggaagagccattcaaggacaag
ctaccccatctctaccagctggtggtccgtcccgataacagctttgagattcgcgttgac
cacaagatcatcaatgagggttccctgctaaccgatttcaagccaccagtcaacccgccg
gcagagatcgacgaccccaatgaccacaagcccgaatcgtgggatgagcgagagaagatc
ccagatcccactgcccacaagcccgaggattgggatgaggatgctccaccccagttgccc
gataccgatgccgtcatgcccaatggctggctcgaagatgagcccgacatgattttcgat
ccaactgccaccaaacccgaggattgggatgccgaaatcgatggcgagtgggaggctcca
ttggtggacaatccagtgtgcgagaaggctcccggctgtggcaagtggaaggctccgctc
atccccaatcccaactacaagggcaagtggcgtgcaccaatgatcgagaaccccaactac
cagggcaagtgggcacccaggaagattcccaatccagacttctttgaggatctgaagccc
ttccaaatgacgcccatcagcgctgtgggtctggaactgtggtccatgtccagcgatatt
ctcttcgacaacctaatcatcacggacgacgtggaggtggcccgtgactttgccgccaac
agcttcgacatcaagcgtcgctacatcgatcgtgaatcgaaaaccttctggcaccgccta
atgcgccgcatgaactacaagcccggctggtgggccctgtacttcgtgtacctgctcatt
ccggccagttgttatgtcttctatctctaccgacgcgccaaagaggactcggctgccaaa
aaggctgctgccgaggccaagaagtccgacgatcctcagcccgacgatgagcccgaggcc
gaggaggagagcgacgaaagggccgctggcgataccagcaaggagagcacaccgctgtcc
gctagtcccaagaagaaccaaaagtctgatttagatgataacgaagaggagtccaaggcg
gcggagagccgagagcccgcacagactgaggaatctaacacaaaaacacgcaagcgtcaa
gcgcgcaaggagtaa

DBGET integrated database retrieval system