KEGG   Drosophila melanogaster (fruit fly): Dmel_CG11992
Entry
Dmel_CG11992      CDS       T00030                                 

Gene name
Rel
Definition
(RefSeq) relish, isoform A
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG11992 (Rel)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG11992 (Rel)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    Dmel_CG11992 (Rel)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank Ank_4 Ank_3 Ank_5
Other DBs
NCBI-GeneID: 41087
NCBI-ProteinID: NP_477094
FlyBase: FBgn0014018
UniProt: Q94527
Position
3R
AA seq 971 aa
MNMNQYYDLDNGKNVMFMNDASSTSGYSSSTSPNSTNRSFSPAHSPKTMELQTDFANLNL
PGGNSPHQPPMANSPYQNQLLNNGGICQLGATNLINSTGVSFGVANVTSFGNMYMDHQYF
VPAPATVPPSQNFGYHQNGLASDGDIKHVPQLRIVEQPVEKFRFRYKSEMHGTHGSLNGA
NSKRTPKTFPEVTLCNYDGPAVIRCSLFQTNLDSPHSHQLVVRKDDRDVCDPHDLHVSKE
RGYVAQFINMGIIHTAKKYIFEELCKKKQDRLVFQMNRRELSHKQLQELHQETEREAKDM
NLNQVRLCFEAFKIEDNGAWVPLAPPVYSNAINNRKSAQTGELRIVRLSKPTGGVMGNDE
LILLVEKVSKKNIKVRFFEEDEDGETVWEAYAKFRESDVHHQYAIVCQTPPYKDKDVDRE
VNVYIELIRPSDDERSFPALPFRYKPRSVIVSRKRRRTGSSANSSSSGTESSNNSLDLPK
TLGLAQPPNGLPNLSQHDQTISEEFGREKHLNEFIASEDFRKLIEHNSSDLEKICQLDMG
ELQHDGHNRAEVPSHRNRTIKCLDDLFEIYKQDRISPIKISHHKVEKWFIEHALNNYNRD
TLLHEVISHKKDKLKLAIQTIQVMNYFNLKDVVNSTLNADGDSALHVACQQDRAHYIRPL
LGMGCNPNLKNNAGNTPLHVAVKEEHLSCVESFLNGVPTVQLDLSLTNDDGLTPLHMAIR
QNKYDVAKKLISYDRTSISVANTMDGNNALHMAVLEQSVELLVLILDAQNENLTDILQAQ
NAAGHTPLELAERKANDRVVQLLKNVYPEKGELAMTWIPCKVKEEIDSSSDESSDAGQLE
IKSEEMDIETKDEDSVELDLSSGPRRQKDESSRDTEMDNNKLQLLLKNKFIYDRLCSLLN
QPLGHGSDPQDRKWMQLARQTHLKQFAFIWLGAEDLLDHVKRKGASVEFSTFARALQAVD
PQAYALLVNPT
NT seq 2916 nt   +upstreamnt  +downstreamnt
atgaacatgaatcagtactacgacctggacaatgggaaaaatgtgatgtttatgaacgat
gcatccagcaccagtggctatagcagcagtacatcacccaactccaccaaccgatccttt
tcaccagcccactccccgaaaaccatggaactgcaaacggacttcgccaatcttaatttg
cccggcggcaattcaccacaccagccgccaatggcaaactcaccataccagaatcagctg
ttgaacaacggcggaatttgccaattgggtgctaccaatttaataaactccactggcgtt
agtttcggcgttgctaatgtcaccagttttggcaacatgtacatggatcaccagtacttt
gtgcccgctccggccactgtgccaccgtcccaaaactttggataccatcaaaatggcctg
gcatctgacggcgatatcaaacacgtgccgcagctgcggatcgttgagcaaccggtggag
aagttccgctttcggtacaagagcgagatgcatggaacacatggatcgctaaatggcgcc
aattcgaagcggacgcccaaaaccttcccggaggttacactgtgcaactacgatggaccc
gccgtcatccggtgcagtttgttccaaactaacttggacagcccacattcccatcagctg
gtcgtgcgcaaggacgatcgggatgtgtgcgatccgcatgatttgcacgtgtccaaggag
cgcggctatgtggcgcaatttatcaacatgggcatcatacacaccgccaagaagtacata
ttcgaggaactgtgcaagaagaagcaggatcgcctggtctttcagatgaaccgccgcgag
ttgtcccacaaacagctacaggaactgcatcaggagacagagcgtgaggccaaggacatg
aacttgaaccaggtgcggctctgctttgaggcctttaaaattgaggacaacggcgcatgg
gttccacttgcaccgcctgtatacagcaatgcaatcaataaccgcaagtcggcacaaact
ggagagcttcgcatcgtccgcctgagcaaacccactggcggggtgatgggcaacgatgag
cttattctactggtggaaaaggtcagcaagaagaacattaaagtgaggttcttcgaggag
gatgaggacggggaaaccgtgtgggaggcatacgcaaagttccgcgaatcggatgtacac
caccaatatgccattgtgtgccagacgcctccgtacaaagataaggacgtggaccgcgag
gtcaacgtgtacatcgagctcattcgtccctccgacgatgagcgctcattcccggcgctg
cccttccgctacaagccacggagcgtaattgtgtcgaggaaacgccgacgaaccgggtcc
tctgccaatagcagcagttcgggaacagaaagctctaataactcgctggatctgcccaaa
acgctgggcttggcgcagccaccaaatggcttgccaaacctttcacagcatgatcagact
ataagtgaggagttcggacgcgaaaagcatctaaatgaatttattgcttccgaagatttc
cgcaaacttatcgagcacaactcttctgatctcgagaagatctgccagttagacatggga
gagttgcagcacgatggtcataaccgggcggaagtgccatcgcatcgaaatcgtacaatt
aaatgcttggatgacttattcgaaatttacaaacaggaccgcatatcgccaataaaaatc
tcgcaccacaaagtggagaagtggtttatcgagcatgctctgaataactacaatagagac
acgctcctgcacgaagtgatcagccacaaaaaggacaaactgaagctggccatccagacg
atacaggtgatgaactacttcaatctgaaagatgtggtcaatagcactttgaatgcggac
ggtgatagtgccctgcatgtggcgtgccagcaagaccgagcgcactacatacgacctttg
ctgggtatgggatgcaatccaaatctgaagaataatgccggaaataccccactgcatgtg
gccgtcaaggaggagcacttaagctgcgtggaaagcttccttaatggagtgccaaccgta
caattggacctctcgctaacgaacgacgatggtctgacgcctttgcacatggccattcga
cagaacaagtacgatgtggccaagaaactgatcagctatgatcggacctcgattagcgtg
gccaacacaatggatggtaataatgcactccacatggcagttctggagcaaagtgtggag
ctattggtgctcattctggatgcccaaaatgaaaaccttaccgacatcctgcaggcacaa
aatgcagccggccatactcccttggaattggccgaacgcaaggcaaatgaccgggtggtc
cagctgctgaagaatgtgtatccggagaagggagaactggccatgacctggattccatgt
aaggtcaaggaggagatcgattcatcgtcggacgaaagtagcgatgctggtcagctggag
atcaagtccgaggagatggacatcgaaacaaaggacgaggattccgtggagttggaccta
agtagtggtccaagaagacagaaagatgaatccagtagagacaccgaaatggacaacaac
aaattgcagttgctgctcaaaaacaaattcatttacgaccggctctgttcgctgctgaat
cagcctttgggacatgggtccgatccccaagatcggaaatggatgcaactagcccgccag
acgcatctgaagcagttcgcctttatatggctgggcgcggaggatctgttggatcacgtg
aaaagaaaaggagcctctgtagagttttccacatttgctcgtgccctgcaggcagtggat
ccacaggcttacgccctactggttaacccaacttga

DBGET integrated database retrieval system