KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12068
Entry
Dmel_CG12068      CDS       T00030                                 
Symbol
sro
Name
(RefSeq) shroud
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00650  Butanoate metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dmel_CG12068 (sro)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Dmel_CG12068 (sro)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR Band_7
Other DBs
NCBI-GeneID: 43512
NCBI-ProteinID: NP_651725
FlyBase: FBgn0262112
UniProt: Q9VAH3
Position
3R
AA seq 335 aa
MSGSQLLRALRRSLGLGRQQLKVDSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHN
IKSEGAKLLQGLASAKDGLSRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINN
AGVMCFGEFEWQLTEQIEAQINCNLLGTMRLTHELLPLLRQQQGRIINVTSHCGLQALPA
LGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSFVLDSNIAARQQQHAQKMREAFSA
EQHALYDTYFEAFNGYLKVLSGFKPPNRLRNESLLAKFKDALTSSQPLALYIEEPRRYRL
YRWLFTLCPTPLVDWLTVRFCAMPTYESTNRQEKI
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagcggcagtcaacttcttcgcgccctgcgacgatccctgggattgggcaggcagcag
ctgaaggtcgatagccggcatgtggtgctcatcacgggctgcgattcgggattgggccac
tccatggcagtttactgccacgaatcgctgcacatgaccgtgatttcctgctgccacaac
atcaagtcggaaggagctaaactgctgcagggcctagcctcggccaaggatggactgagc
agaatgcacaccttggaactggatctattggaacccgattccattcgcctggtgcatcgc
cagctaagggacatactggccaaagaccccagctatcggctgacggcactgataaacaat
gctggagtaatgtgcttcggggaattcgagtggcagctaacggagcagatcgaggcgcag
atcaactgcaacctgctgggcaccatgaggctgacacatgaactgctgcccctgctccgg
cagcagcagggcaggatcatcaatgtgaccagccactgcggattgcaggctctgccggca
ctgggtccttatgccgcctccaaggcagcccttcgcttctggacggattcactccgcgtg
gagctgcagcagtatggcatggaggtggtcaacttcataccaggctccttcgtcctggac
agcaacattgcggccagacagcagcagcatgctcagaagatgcgcgaagccttcagtgcg
gagcaacacgctctgtacgacacttacttcgaggccttcaatggttatctgaaagtactg
agcggcttcaagccgcccaatcgcctgaggaacgagtcgctgctggcaaagtttaaggat
gcattgaccagctcacaacccttggctctgtacatcgaggaaccccgtagatatcgcctc
tatcgctggctctttacgctctgccccactccgctagtggattggctcacggtgcgtttc
tgcgcgatgcccacctacgagtcaacgaacaggcaggagaagatttag

DBGET integrated database retrieval system