KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12151Help
Entry
Dmel_CG12151      CDS       T00030                                 

Gene name
Pdp
Definition
(RefSeq) pyruvate dehydrogenase phosphatase, isoform B
  KO
K01102  pyruvate dehydrogenase phosphatase [EC:3.1.3.43]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG12151 (Pdp)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.43  [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase
     Dmel_CG12151 (Pdp)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   Pyruvate dehydrogenase phosphatases
    Catalytic subunit
     Dmel_CG12151 (Pdp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C FAS_N
Motif
Other DBs
NCBI-GeneID: 31683
NCBI-ProteinID: NP_001245567
FlyBase: FBgn0029958
UniProt: Q9W3Q1
Position
X
AA seq 475 aa AA seqDB search
MFKFVLNDAASYVRSNVREFSLNALRLLPQLPQLSPYDVNLVLRENEFVYNFPVDGVIRS
YETNQLGSNWPCEDSRTEASFLHRNGFICGIFDGHAGAACGQVVSKRLLRYVSAATLPRQ
VLREQMKQGADSQSFLKCHNDNVDFVSMIKPMYEASFLKYVNQLLETPQRDVSSELVNAF
LQLDEEISQEALTSNDVRTMNVALSGAVACLVHIEGLQMHVASTGDCGAVLGVLDPQTQQ
WHSKKLNIEHNADNMSEVRRILAEHPKEEHETVIRNGRLLSQLAPLRAFGDFRYKWSQEI
MQQKVLPMFGVQAMAPNYYTPPYLTARPDVQQHELGPNDKFLVIASDGLWDFLPPSEVVS
LVGEHINSKKILEPMRLPEGDTTLQEISQQLAERKAGLTRKPVDQNAATHLIRHALGGTD
YGIEHSKISYYLTLPRDAVRLYRDDITITVIYFNSEHIAKLHSDVDQTEVTAPVA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagttcgtgctgaacgacgccgccagctacgtgcgatccaatgtgcgggagttc
agtttgaatgcactgcgtctgctgccgcaactgcctcaattgagtccatacgatgttaac
cttgttctgagggagaacgagttcgtttacaactttcccgtggatggagtcatccgcagc
tatgaaacaaatcagctgggatcaaactggccctgcgaggattcccgcacggaggccagc
ttcctgcaccgcaacggcttcatttgtggcattttcgacgggcatgcgggagcagcatgt
ggccaagtggtgtccaagcgactgcttcgctatgtttcggcggccacgctgccgcgccag
gtgctccgggagcagatgaagcagggtgccgacagccagtcgttcctcaagtgccacaat
gacaacgtggactttgttagcatgatcaagcccatgtacgaggctagtttcctcaagtat
gtcaatcaattgttagagacaccgcaacgggatgtatccagtgaactggtgaacgccttc
ctccagctggatgaagagatctcgcaggaggctctgaccagcaacgatgtacgcaccatg
aacgtggccctttctggagccgttgcctgtttggttcacattgagggactgcagatgcac
gtggccagcacgggtgattgtggcgcagtgttgggcgttcttgatccccagacgcagcag
tggcactcaaagaagcttaacatcgaacacaatgctgacaatatgtccgaggtgcgtcgc
attctggccgagcatcccaaggaggagcatgagacggtgatccgaaacggcaggctgctt
agccagctggcgccgttgcgtgcctttggggactttcgctacaagtggtcccaggaaata
atgcagcagaaggtgctgccgatgttcggcgtgcaggcaatggcgccgaattactatacg
ccaccgtacctaaccgcccgccccgatgtccagcagcacgaattggggcccaacgacaag
tttctagtcatcgccagcgacggcctatgggatttccttccgcccagcgaggtggtcagc
ttggtgggggagcacatcaactccaaaaagatcctcgaaccgatgcgcctgccggaaggc
gatacaacgctgcaggaaatctctcagcagctggccgaaagaaaggctggcctcactcgc
aaacccgtagaccaaaacgcggccacgcatctcatccggcatgctttgggcggcaccgac
tatgggattgagcactcgaagatctcgtactatttgacgctgcccagggacgcggtgcgt
ctgtatcgcgacgacatcacaatcactgtcatctactttaactcggagcacattgccaag
ctgcacagcgatgtggatcaaacggaggtcactgcgccggtagcatga

DBGET integrated database retrieval system