KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12172
Entry
Dmel_CG12172      CDS       T00030                                 

Gene name
Spn43Aa
Definition
(RefSeq) serpin 43Aa
  KO
K13963  serpin B
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG12172 (Spn43Aa)
Peptidases and inhibitors [BR:dme01002]
 Peptidase inhibitors
  Family I4: serpin family
   Dmel_CG12172 (Spn43Aa)
SSDB
Motif
Pfam: Serpin HTH_40
Other DBs
NCBI-GeneID: 45041
NCBI-ProteinID: NP_524805
FlyBase: FBgn0024294
UniProt: Q7KA66
Position
2R
AA seq 390 aa
MNHWLSIILLGVWISAPEGLGNTIKDRNLFATELFQTLATDRQDENVIISPVSIQLALGL
AYYGAEGRTAAELQKTLHASAKESKDGLAESYHNLLHSYIKSKTVLEIANKVYTRQNLTV
SSHFREVAQKYFDSEVEPLDFSRETEAVEQINRWVKQQTENKIERVVESLEPDTNVALVN
AIYFKARWARPFNDEDTRDREFWLSESRSIQVPTMFADNWYYYADYPELDAKAIELFFEN
INLTMWFILPNQRSGLQALEQKLKGVDFNLLEDRWQWQSVSVYLPKFKFEFDTDLRPTLH
KMGISAMFSDAADFSNIFQDSPIGTRITKVQHKTFIDVNEIGCEAAGASYAAGVPMSLPL
DPKTFVADHPFAFIIRDKHAVYFTGHIVKF
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaaccactggctaagtatcattcttcttggggtgtggatatccgctcctgaaggtctg
ggtaacacgatcaaggatcgcaatctcttcgccaccgaactcttccaaaccctcgccaca
gatcgccaggatgagaacgtgatcatctcgccggtttccatccagctggccctcgggttg
gcttactacggagctgagggcaggacggccgcggaactgcagaagaccttgcacgcctcc
gccaaggagagcaaagatggtctggccgagagctaccacaacctgctgcactcttacatc
aagtccaagaccgtgttggagatcgccaacaaggtgtacacccggcagaatctcacggta
tctagccacttccgagaggtggcccagaagtacttcgactccgaggtagaaccactggac
ttcagtcgcgaaacggaggccgtggagcagatcaaccgctgggtgaagcagcagacggag
aacaagatcgaacgggtggtggaaagcctggagccggacaccaatgtggcgctggtcaac
gccatctacttcaaggctcgctgggcacgacccttcaacgacgaggatacccgggatcgc
gagttctggctgagcgagagccggtccatccaggtgccaaccatgttcgcagacaactgg
tactactacgccgactacccggaactcgacgccaaggccattgagctgttcttcgaaaac
atcaacctgaccatgtggttcatcctgcccaaccagcgttccggactacaggctctggag
cagaagctcaagggcgtcgacttcaatctgctcgaagaccgctggcagtggcagagtgtg
tccgtttacctgcccaagttcaagttcgagttcgacacggacctaagacccacattgcat
aagatgggaatcagtgccatgttctcagatgcagccgacttcagcaacattttccaggac
tcgcccatcggcactcggatcacaaaggtgcagcacaagaccttcatcgatgtgaacgag
atcggatgtgaggcggctggagctagttatgctgccggagttcccatgtccctgcccctg
gaccccaagactttcgtggccgatcatccatttgcgttcatcattcgcgacaagcacgct
gtctatttcaccggacacattgtcaagttttaa

DBGET integrated database retrieval system