KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12223
Entry
Dmel_CG12223      CDS       T00030                                 

Gene name
Dsp1
Definition
(RefSeq) dorsal switch protein 1, isoform E
  KO
K10802  high mobility group protein B1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03410  Base excision repair
dme04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Dmel_CG12223 (Dsp1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG12223 (Dsp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG12223 (Dsp1)
   03400 DNA repair and recombination proteins [BR:dme03400]
    Dmel_CG12223 (Dsp1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG12223 (Dsp1)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    Dmel_CG12223 (Dsp1)
DNA repair and recombination proteins [BR:dme03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     Dmel_CG12223 (Dsp1)
   MMR (mismatch excision repair)
    Other MMR factors
     Dmel_CG12223 (Dsp1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dmel_CG12223 (Dsp1)
SSDB
Motif
Pfam: HMG_box HMG_box_2 Spt20 DUF2722 HMG_box_5 Med15
Other DBs
NCBI-GeneID: 117294
NCBI-ProteinID: NP_996485
FlyBase: FBgn0278608
UniProt: Q24537
Position
X
AA seq 393 aa
MEHFHQIQQTIQHYQQQLAAQQQQQVQQQQLQQHQVVVQQNQQQAHQNSSNTTAGVGTQQ
LFTYKMASSFPNPATTMAQVVATSNAAGTTGYDYRLNMAQAAAAAAVPGSQWWYSAANQG
QVDANTAAQLQHQQQQQQQQQQQQQQQHQQQQQMQQQQQQQNVINSASPMSRVKADAKPR
GRMTAYAYFVQTCREEHKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQR
YEAEMQNYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGD
IAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAMSAPSMQASMQAQAQ
KAALLAAAAQQQHQQLEEQHDDDDGDGDDDENQ
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaacactttcatcaaatacagcaaacaattcaacactatcagcagcaattggctgct
cagcaacaacaacaagtacaacagcaacagttgcaacaacaccaggtggtcgtccagcag
aatcagcagcaggcgcaccagaacagctccaataccacagccggcgtgggcacccaacag
ctgttcacatacaaaatggccagcagttttccgaatccggccacgacgatggcccaagtg
gtggccacatcgaacgcagccggcaccacgggctatgattatcgtctaaatatggcacag
gcagccgcagcagcagccgtacccggctcccagtggtggtattcggccgccaatcaggga
caggtcgatgccaatacagcggcgcaactgcagcaccagcagcagcaacagcaacagcaa
caacagcagcagcagcaacagcaccagcagcaacaacagatgcaacagcagcagcagcaa
cagaatgtcatcaattcggcgagccccatgagcagagtcaaggccgatgccaagcccaga
ggccgaatgaccgcctacgcatactttgtacaaacttgcagagaggagcacaaaaagaaa
catcccgatgagacggtgatattcgccgaattctcgcggaagtgcgccgaacggtggaag
acaatggtggacaaggagaagaagcgcttccacgaaatggccgagaaggacaagcagcga
tatgaggcggaaatgcagaactatgtgccgcccaagggagcggttgtgggacgcggcaag
aagaggaaacagatcaaggaccccaatgctccaaaacgttcattgtctgcgttcttctgg
ttctgcaatgacgagagaaataaggtgaaggcacttaatcccgagttcggagtgggcgac
atcgccaaagagctgggacgaaagtggtccgatgtggatcccgaggtcaagcagaagtac
gagtcgatggccgagcgggacaaggctcgatatgaacgcgagatgaccgagtacaagacg
agcgggaaaatagccatgtccgcaccgtcgatgcaggcgtcgatgcaggcgcaggcacag
aaagccgcgttacttgccgccgctgcccagcagcagcaccagcagctggaagagcagcac
gacgacgacgacggcgatggagatgatgacgagaaccaatag

DBGET integrated database retrieval system