KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12244
Entry
Dmel_CG12244      CDS       T00030                                 

Symbol
lic
Name
(RefSeq) licorne
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG12244 (lic)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG12244 (lic)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG12244 (lic)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG12244 (lic)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: STE group
  STE7 family
   Dmel_CG12244 (lic)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Seadorna_VP7 Choline_kinase APH RIO1
Other DBs
NCBI-GeneID: 32257
NCBI-ProteinID: NP_477162
FlyBase: FBgn0261524
UniProt: O62602
Position
X
AA seq 334 aa
MSKRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIV
DKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWI
CMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI
NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGM
IEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQ
LLKHSFIVEHLQRNTDISEFVARILDLPDAQPAQ
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtccaaacgccaccgcctcacgccctttaccattgccaaggagccagaggccgccata
gtcccgccacgcaacctggactcgcgggccaccatccaaattggcgaccggacctttgac
atcgatgcagatagtctcgagaagatctgcgatctgggccgtggcgcctatggcatcgtg
gataagatgcgccataagcaaaccgatacggtcctggccgtcaaacgcatacccatgacc
gtaaatattcgagaacagcaccgccttgtaatggatttggacatatcgatgagatccagc
gactgcccctacaccgtccacttttatggtgcgatgtatcgcgagggcgatgtctggatt
tgcatggaggtgatgagcaccagcctggacaagttctatccgaaggtcttccttcacgat
ctgcgaatggaggaaagcgtgctgggcaagattgccatgagcgtggtcagtgcgctgcac
tatctgcacgctcaactgaaagtcattcatcgggacgtcaagccctcgaacatactgatc
aatcgggccggccaggtcaagatctgtgactttggcatctcaggctacctcgtcgactcc
attgccaaaaccattgatgccggttgcaagccgtacatggcgccggaacggatcgatccc
caaggaaatccggcgcaatacgacatcaggtcggatgtttggtcgctgggcatcggcatg
atcgaaatggccacgggccgctacccatacgacaattggcgaacgccatttgagcaactg
cgtcaggtggttgaggacagtccgccgcgcctgccggagggaacattttcgccggaattc
gaggacttcatcgccgtctgcctgcagaaggagtatatggcaaggcccaactacgagcag
ctgctcaagcacagcttcatcgtggagcacctgcagcgcaacacggacatctcggagttc
gtggccaggatactggatctgcccgacgcgcagccggcgcagtag

DBGET integrated database retrieval system